Advanced Search (OLGA)

Gene: Gpx6 (glutathione peroxidase 6) Rattus norvegicus

Analyze

Symbol:

Gpx6

Name:

glutathione peroxidase 6

RGD ID:

628789

Description:

Predicted to enable glutathione peroxidase activity. Predicted to be involved in cellular oxidant detoxification and response to oxidative stress. Predicted to be located in extracellular region. Orthologous to human GPX6 (glutathione peroxidase 6); PARTICIPATES IN arachidonic acid metabolic pathway; glutathione metabolic pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

GPx-6; GSHPx-6; OBPII; odorant-metabolizing protein RY2D1; Ry2d1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GPX6 (glutathione peroxidase 6)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Gpx6 (glutathione peroxidase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GPX6 (glutathione peroxidase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GPX6 (glutathione peroxidase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gpx6 (glutathione peroxidase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GPX6 (glutathione peroxidase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GPX6 (glutathione peroxidase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GPX3 (glutathione peroxidase 3)	HGNC	OrthoDB
Alliance orthologs ³
Mus musculus (house mouse):	Gpx6 (glutathione peroxidase 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GPX6 (glutathione peroxidase 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gpx3 (glutathione peroxidase 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gpx-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gpx-5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gpx3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	48,104,197 - 48,111,816 (-)	NCBI		GRCr8
mRatBN7.2	17	43,408,472 - 43,416,091 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	43,408,472 - 43,416,091 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	45,465,782 - 45,473,456 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	50,224,885 - 50,232,558 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	44,715,478 - 44,723,148 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	45,439,268 - 45,446,952 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	45,439,268 - 45,446,907 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	58,020,331 - 58,027,779 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	51,063,379 - 51,068,058 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	51,066,219 - 51,070,899 (-)	NCBI
Celera	17	53,062,670 - 53,070,210 (+)	NCBI		Celera
Cytogenetic Map	17	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

Huntington's disease (ISO)

megacolon (ISO)

ovarian carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17alpha-ethynylestradiol (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

3-phenylprop-2-enal (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

alachlor (EXP)

ammonium chloride (EXP)

atrazine (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (EXP)

bisphenol A (EXP,ISO)

C60 fullerene (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

choline (ISO)

Cuprizon (EXP)

dextran sulfate (ISO)

diazinon (EXP)

dieldrin (EXP)

folic acid (ISO)

fulvestrant (ISO)

L-methionine (ISO)

lycopene (ISO)

N,N-diethyl-m-toluamide (EXP)

N-nitrosodiethylamine (EXP)

naphthalene (ISO)

nickel atom (EXP)

PCB138 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

permethrin (EXP)

Pyridostigmine bromide (EXP)

quercetin (ISO)

sodium fluoride (ISO)

tetraphene (ISO)

tributylstannane (ISO)

Tributyltin oxide (ISO)

triptonide (ISO)

valproic acid (ISO)

vancomycin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular oxidant detoxification (IEA)

response to oxidative stress (IEA)

Cellular Component

extracellular region (IEA)

Molecular Function

glutathione peroxidase activity (IBA)

peroxidase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

arachidonic acid metabolic pathway (IEA)

glutathione metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Molecular cloning of putative odorant-binding and odorant-metabolizing proteins.	Dear TN, etal., Biochemistry 1991 Oct 29;30(43):10376-82.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Proteomic and oxidative stress analysis in human brain samples of Huntington disease.	Sorolla MA, etal., Free Radic Biol Med. 2008 Sep 1;45(5):667-78. doi: 10.1016/j.freeradbiomed.2008.05.014. Epub 2008 May 28.

Additional References at PubMed

PMID:12775843	PMID:37761814

Genomics

Comparative Map Data

Gpx6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	48,104,197 - 48,111,816 (-)	NCBI		GRCr8
mRatBN7.2	17	43,408,472 - 43,416,091 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	43,408,472 - 43,416,091 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	45,465,782 - 45,473,456 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	50,224,885 - 50,232,558 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	44,715,478 - 44,723,148 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	45,439,268 - 45,446,952 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	45,439,268 - 45,446,907 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	58,020,331 - 58,027,779 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	51,063,379 - 51,068,058 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	51,066,219 - 51,070,899 (-)	NCBI
Celera	17	53,062,670 - 53,070,210 (+)	NCBI		Celera
Cytogenetic Map	17	q11	NCBI

GPX6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	28,503,296 - 28,515,793 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	28,503,296 - 28,528,215 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	28,471,073 - 28,483,570 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	28,579,052 - 28,591,549 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	28,579,051 - 28,591,549	NCBI
Celera	6	30,077,501 - 30,089,997 (-)	NCBI		Celera
Cytogenetic Map	6	p22.1	NCBI
HuRef	6	28,277,455 - 28,289,954 (-)	NCBI		HuRef
CHM1_1	6	28,473,472 - 28,485,969 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	28,374,721 - 28,387,222 (-)	NCBI		T2T-CHM13v2.0

Gpx6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	21,479,635 - 21,503,795 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	21,496,295 - 21,503,794 (+)	Ensembl		GRCm39 Ensembl
GRCm38	13	21,295,465 - 21,319,625 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	21,312,125 - 21,319,624 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	21,404,072 - 21,411,493 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	21,319,715 - 21,327,085 (+)	NCBI		MGSCv36	mm8
Celera	13	21,579,151 - 21,586,567 (+)	NCBI		Celera
Cytogenetic Map	13	A3.1	NCBI
cM Map	13	7.74	NCBI

GPX6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	43,129,197 - 43,143,584 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	39,130,146 - 39,144,534 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	28,317,217 - 28,330,024 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	28,988,742 - 29,000,265 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	28,988,742 - 29,000,265 (-)	Ensembl	panpan1.1		panPan2

GPX6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	35	25,620,843 - 25,630,288 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	35	25,620,111 - 25,631,062 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	35	25,480,125 - 25,489,572 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	35	25,919,111 - 25,928,723 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	35	25,918,379 - 25,929,103 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	35	25,583,022 - 25,592,453 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	35	25,638,367 - 25,647,972 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	35	27,107,104 - 27,116,712 (-)	NCBI		UU_Cfam_GSD_1.0

Gpx6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	28,905,318 - 28,913,519 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936914	535,324 - 543,114 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936914	535,324 - 543,114 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GPX6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	22,256,038 - 22,267,992 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	22,256,013 - 22,267,992 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	24,199,978 - 24,211,985 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GPX6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	44,046,748 - 44,058,881 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666044	28,204,307 - 28,215,400 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Gpx6
25 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	120
Count of miRNA genes:	91
Interacting mature miRNAs:	94
Transcripts:	ENSRNOT00000058270
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631497	Bp98	Blood pressure QTL 98	3.66		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	41354651	60463643	Rat
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
1358295	Aocep1	Aortic cell protein QTL 1	6.1	7e-07	thoracic aorta cellular protein amount (VT:0010598)	aortic cell percentage	17	40990005	85990005	Rat
1354640	Scl32	Serum cholesterol level QTL 32	5.4		blood HDL cholesterol amount (VT:0000184)	blood high density lipoprotein cholesterol level (CMO:0000052)	17	15781592	60781592	Rat
152023626	Bp403	Blood pressure QTL 403	3.86		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	37479847	82479847	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	28409147	73409147	Rat
2302377	Scl61	Serum cholesterol level QTL 61	4.36		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	17	27389946	53481766	Rat
70157	Niddm32	Non-insulin dependent diabetes mellitus QTL 32	4.34		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	22454924	50909196	Rat
724549	Niddm56	Non-insulin dependent diabetes mellitus QTL 56		0.03	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	31990784	76990784	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40540041	80387013	Rat
1354628	Stl13	Serum triglyceride level QTL 13	3.8		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	21293039	60781592	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27027949	56836890	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4528038	49528038	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
61394	Bp8	Blood pressure QTL 8	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	23080567	59555013	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	68653184	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	31368391	62109574	Rat
152025238	Slep14	Serum leptin concentration QTL 14	4.62		blood leptin amount (VT:0005667)		17	24184890	79524188	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
2313854	Bp343	Blood pressure QTL 343	3.9		life span trait (VT:0005372)	age at time of death (CMO:0001193)	17	31990784	50909196	Rat
2317054	Aia12	Adjuvant induced arthritis QTL 12	4.24		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	38281509	83281509	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	42073160	69599340	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15330613	55836425	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	28409147	73409147	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	34550843	73951021	Rat
2317060	Aia26	Adjuvant induced arthritis QTL 26	3.22		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	38281509	83281509	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4528038	49528038	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23653184	68653184	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23653184	68653184	Rat
4889955	Bss93	Bone structure and strength QTL 93	4.4		tibia size trait (VT:0100001)	tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727)	17	27027949	60463643	Rat
2303561	Bw91	Body weight QTL 91	2		body mass (VT:0001259)	body weight (CMO:0000012)	17	8868462	53868462	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23653184	70974005	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23653184	68653184	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	31368391	73951021	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23653184	68653184	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	24599340	69599340	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
152023740	Bp406	Blood pressure QTL 406	6.06		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	31990784	81292925	Rat
7488966	Bp370	Blood pressure QTL 370		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	57246843	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
152023737	Bp405	Blood pressure QTL 405	5.06		arterial blood pressure trait (VT:2000000)			23930421	79524188	Rat
1354659	Scl68	Serum cholesterol level QTL 68	3.9		blood VLDL cholesterol amount (VT:0005144)	blood very low density lipoprotein cholesterol level (CMO:0000648)	17	15781592	60781592	Rat
152023736	Bp404	Blood pressure QTL 404	3.78		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat
724528	Uae4	Urinary albumin excretion QTL 4	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	17	35837085	69599340	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

appendage	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
1	9	11	10	1	6	1	1	11	6	8	3	29	9

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_147165	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474072	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M76733	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000079035 ⟹ ENSRNOP00000070683

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	17	45,439,707 - 45,446,907 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000082782 ⟹ ENSRNOP00000070342

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	43,408,472 - 43,416,091 (-)	Ensembl
Rnor_6.0 Ensembl	17	45,439,268 - 45,446,857 (-)	Ensembl

RefSeq Acc Id:

NM_147165 ⟹ NP_671694

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	48,104,197 - 48,111,816 (-)	NCBI
mRatBN7.2	17	43,408,472 - 43,416,091 (-)	NCBI
Rnor_6.0	17	45,439,268 - 45,446,952 (-)	NCBI
Rnor_5.0	17	58,020,331 - 58,027,779 (+)	NCBI
RGSC_v3.4	17	51,063,379 - 51,068,058 (-)	RGD
Celera	17	53,062,670 - 53,070,210 (+)	RGD

Sequence:

show sequence

ACAGTTCCTGAGGTCTGAGACTCATCCAGTCTTCTTTGTACAACCATGACCCAGCAGTTCTGGG
GTCCCTGTCTTTTCTCATTGTTTATGGCTGTATTGGCTCAGGAGACACTGGATCCTCAAAAATC
AAAGGTGGATTGCAACAAAGGGGTGGCTGGCACCGTCTATGAGTACGGAGCCAACACCTTAGAT
GGTGGGGAGTATGTCCAGTTCCAGCAGTATGCAGGAAAGCACATTCTCTTTGTCAACGTGGCGT
CCTTCTGTGGCCTGACAGCTACGTACCCTGAACTGAACACATTGCAGGAGGAGCTGAGACCATT
CAATGTCAGTGTTTTGGGCTTTCCATGCAACCAGTTTGGAAAACAAGAACCTGGAAAGAACTCA
GAGATCCTCCTTGGACTCAAATATGTTCGCCCAGGCGGTGGCTTTGTTCCCAATTTCCAGCTCT
TTGAGAAGGGGGATGTGAACGGAGACAATGAACAAAAGGTTTTTTCTTTCCTAAAGAGCTCCTG
CCCTCCCACCTCTGAACTTCTTGGCTCTCCAGAACATCTCTTCTGGGATCCCATGAAGGTCCAT
GACATTCGCTGGAACTTTGAGAAGTTCCTGGTGGGACCGGATGGAGCCCCTGTCATGCGCTGGT
TCCACCAGACTCCTGTCAGAGTTGTCCAGTCAGACATCATGGAGTACCTAAACCAAACCCGTAC
CCAGTAGGATGTTTTACAAATAGTGCCTTTGCTCCACCCCTTCACCAGCCTCCATATGATCAAA
GCCTGCAACACTACTTGTGTCCTTACTAATGTGTGTACAAACAGAAGTTTATTTGTGGTAGGCA
TATGCATGCATTGGAAATTAAGTTAAAAAAAAAACAATTATCCACCCAGATATCTGACTCTCAT
ATATCTAGTTTCCCTAATCTAGTCCAAAAGAAAGTCATATTTTGGCAATGATGATCCAGACAAT
TCCATATATCTAAAAAGTGATCTACCAAGACCCTAATCTATCATTCACAGCACTGGTGGGTTAA
AAGAAGTGGGAACGGGTGGCCAGATCCTCTGGGTCCCAGTATCTTCTCCTCCCAAGCTGGGCAT
GCTTTGTCAAGCTCTCCTTCTGTTTAGCTCCTTAGTACAACACTGACCCATAGTTATCTTAGG

hide sequence

Protein Sequences


Protein RefSeqs	NP_671694	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA42094	(Get FASTA)	NCBI Sequence Viewer
	EDL84537	(Get FASTA)	NCBI Sequence Viewer
	EDL84538	(Get FASTA)	NCBI Sequence Viewer
	EDL84539	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000070342
	ENSRNOP00000070342.2
GenBank Protein	Q64625	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_671694 ⟸ NM_147165
- Peptide Label:	precursor
- UniProtKB:	Q64625 (UniProtKB/Swiss-Prot), A6KN70 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTQQFWGPCLFSLFMAVLAQETLDPQKSKVDCNKGVAGTVYEYGANTLDGGEYVQFQQYAGKHI LFVNVASFCGLTATYPELNTLQEELRPFNVSVLGFPCNQFGKQEPGKNSEILLGLKYVRPGGGF VPNFQLFEKGDVNGDNEQKVFSFLKSSCPPTSELLGSPEHLFWDPMKVHDIRWNFEKFLVGPDG APVMRWFHQTPVRVVQSDIMEYLNQTRTQ hide sequence

Ensembl Acc Id:

ENSRNOP00000070683 ⟸ ENSRNOT00000079035

Ensembl Acc Id:

ENSRNOP00000070342 ⟸ ENSRNOT00000082782

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q64625-F1-model_v2	AlphaFold	Q64625	1-221	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628789	AgrOrtholog
BioCyc Gene	G2FUF-9205	BioCyc
Ensembl Genes	ENSRNOG00000060749	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000082782	UniProtKB/TrEMBL
	ENSRNOT00000082782.2	UniProtKB/Swiss-Prot
Gene3D-CATH	Glutaredoxin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Glutathione_peroxidase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPX_AS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPX_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Thioredoxin-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:259233	UniProtKB/Swiss-Prot
NCBI Gene	259233	ENTREZGENE
PANTHER	GLUTATHIONE PEROXIDASE 6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11592	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	GSHPx	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Gpx6	PhenoGen
PIRSF	Glutathion_perox	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	GLUTPROXDASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	GLUTATHIONE_PEROXID_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GLUTATHIONE_PEROXID_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GLUTATHIONE_PEROXID_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000060749	RatGTEx
Superfamily-SCOP	SSF52833	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2JXN4_RAT	UniProtKB/TrEMBL
	A6KN69_RAT	UniProtKB/TrEMBL
	A6KN70	ENTREZGENE, UniProtKB/TrEMBL
	A6KN71_RAT	UniProtKB/TrEMBL
	GPX6_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-12-14	Gpx6	glutathione peroxidase 6	Ry2d1	odorant-metabolizing protein RY2D1	Symbol and Name updated	1299863	APPROVED
2003-02-27	Ry2d1	odorant-metabolizing protein RY2D1			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_homology	has significant homology to VEG protein	634024

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)