Advanced Search (OLGA)

Gene: Htr5a (5-hydroxytryptamine receptor 5A) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Htr5a

Name:

5-hydroxytryptamine receptor 5A

RGD ID:

2851

Description:

Enables G protein-coupled serotonin receptor activity. Involved in G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger; hippocampus development; and response to estradiol. Located in dendrite and perikaryon. Is active in postsynaptic specialization membrane. Orthologous to human HTR5A (5-hydroxytryptamine receptor 5A); PARTICIPATES IN calcium/calcium-mediated signaling pathway; INTERACTS WITH (S)-amphetamine; 17alpha-ethynylestradiol; alendronic acid.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

5-HT-5A; 5-HT5A; 5-hydroxytryptamine (serotonin) receptor 5A; 5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled; 5HT5A; MR22; REC17; serotonin receptor 5A

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	8,178,802 - 8,188,485 (-)	NCBI		GRCr8
mRatBN7.2	4	7,444,968 - 7,454,651 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	7,444,968 - 7,454,651 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	12,455,005 - 12,464,692 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	8,269,250 - 8,278,935 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	6,615,442 - 6,625,127 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	199,916 - 209,599 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	199,916 - 209,599 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	192,554 - 202,795 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	2,707,261 - 2,716,944 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	2,707,260 - 2,716,944 (-)	NCBI
Celera	4	2,826,290 - 2,835,975 (+)	NCBI		Celera
Cytogenetic Map	4	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Htr5a	Rat	intracranial hypertension		ISO	HTR5A (Homo sapiens)	329969876	mRNA:increased expression:neocortex and Pyramidal cells (human)	RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Htr5a	Rat	autistic disorder		ISO	HTR5A (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autism	ClinVar	PMID:21681106 and PMID:30208311
Htr5a	Rat	holoprosencephaly 3		ISO	HTR5A (Homo sapiens)	8554872	ClinVar Annotator: match by term: Holoprosencephaly 3	ClinVar	PMID:10631160 more ...
Htr5a	Rat	prostate cancer		ISO	HTR5A (Homo sapiens)	8554872	ClinVar Annotator: match by term: Malignant tumor of prostate	ClinVar	PMID:23265383

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Htr5a	Rat	autistic disorder		ISO	HTR5A (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:17203304

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Htr5a	Rat	(S)-amphetamine	increases expression	EXP		6480464	Dextroamphetamine results in increased expression of HTR5A mRNA	CTD	PMID:16715494
Htr5a	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Htr5a (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of HTR5A mRNA	CTD	PMID:22206623
Htr5a	Rat	17alpha-ethynylestradiol	affects expression	EXP		6480464	Ethinyl Estradiol affects the expression of HTR5A mRNA	CTD	PMID:16079270
Htr5a	Rat	4,4'-sulfonyldiphenol	increases methylation	ISO	HTR5A (Homo sapiens)	6480464	bisphenol S results in increased methylation of HTR5A gene	CTD	PMID:31601247
Htr5a	Rat	alendronic acid	affects expression	EXP		6480464	Alendronate affects the expression of HTR5A mRNA	CTD	PMID:16079270
Htr5a	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of HTR5A mRNA	CTD	PMID:16483693
Htr5a	Rat	benzene	decreases expression	ISO	HTR5A (Homo sapiens)	6480464	Benzene results in decreased expression of HTR5A mRNA	CTD	PMID:21843810
Htr5a	Rat	benzo[a]pyrene	multiple interactions	ISO	Htr5a (Mus musculus)	6480464	Benzo(a)pyrene promotes the reaction [AHR protein binds to HTR5A promoter]	CTD	PMID:19654925
Htr5a	Rat	benzo[a]pyrene	affects methylation	ISO	HTR5A (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of HTR5A 3' UTR and Benzo(a)pyrene affects the methylation of HTR5A exon	CTD	PMID:27901495
Htr5a	Rat	benzo[a]pyrene	increases methylation	ISO	HTR5A (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of HTR5A 5' UTR and Benzo(a)pyrene results in increased methylation of HTR5A promoter	CTD	PMID:27901495
Htr5a	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of HTR5A mRNA	CTD	PMID:25181051 and PMID:34947998
Htr5a	Rat	bisphenol F	increases expression	ISO	HTR5A (Homo sapiens)	6480464	bisphenol F results in increased expression of HTR5A mRNA	CTD	PMID:33476716
Htr5a	Rat	bisphenol F	decreases expression	EXP		6480464	4 and 4'-bisphenol F results in decreased expression of HTR5A mRNA	CTD	PMID:26186136
Htr5a	Rat	bleomycin A2	decreases expression	EXP		6480464	Bleomycin results in decreased expression of HTR5A mRNA	CTD	PMID:15808516
Htr5a	Rat	cadmium dichloride	increases methylation	EXP		6480464	Cadmium Chloride results in increased methylation of HTR5A promoter	CTD	PMID:22457795
Htr5a	Rat	chlorpyrifos	decreases expression	EXP		6480464	Chlorpyrifos results in decreased expression of HTR5A mRNA	CTD	PMID:17452286
Htr5a	Rat	chlorpyrifos	increases expression	EXP		6480464	Chlorpyrifos results in increased expression of HTR5A mRNA	CTD	PMID:18835401
Htr5a	Rat	clofibrate	decreases expression	ISO	Htr5a (Mus musculus)	6480464	Clofibrate results in decreased expression of HTR5A mRNA	CTD	PMID:17585979
Htr5a	Rat	crocidolite asbestos	increases expression	ISO	Htr5a (Mus musculus)	6480464	Asbestos and Crocidolite results in increased expression of HTR5A mRNA	CTD	PMID:19446018
Htr5a	Rat	diazinon	affects expression	EXP		6480464	Diazinon affects the expression of HTR5A mRNA	CTD	PMID:17452286
Htr5a	Rat	dieldrin	increases expression	EXP		6480464	Dieldrin results in increased expression of HTR5A mRNA	CTD	PMID:18835401
Htr5a	Rat	formaldehyde	increases expression	EXP		6480464	Formaldehyde results in increased expression of HTR5A mRNA	CTD	PMID:12679049
Htr5a	Rat	fulvestrant	increases methylation	ISO	HTR5A (Homo sapiens)	6480464	Fulvestrant results in increased methylation of HTR5A gene	CTD	PMID:31601247
Htr5a	Rat	genistein	multiple interactions	EXP		6480464	[Genistein co-treated with Methoxychlor] results in decreased expression of HTR5A mRNA	CTD	PMID:21782745
Htr5a	Rat	graphite	affects expression	EXP		6480464	Graphite affects the expression of HTR5A mRNA	CTD	PMID:29933104
Htr5a	Rat	lead diacetate	increases expression	ISO	Htr5a (Mus musculus)	6480464	lead acetate results in increased expression of HTR5A mRNA	CTD	PMID:20542052
Htr5a	Rat	lead(0)	affects expression	ISO	HTR5A (Homo sapiens)	6480464	Lead affects the expression of HTR5A mRNA	CTD	PMID:28903495
Htr5a	Rat	methoxychlor	multiple interactions	EXP		6480464	[Genistein co-treated with Methoxychlor] results in decreased expression of HTR5A mRNA	CTD	PMID:21782745
Htr5a	Rat	paracetamol	decreases expression	ISO	HTR5A (Homo sapiens)	6480464	Acetaminophen results in decreased expression of HTR5A mRNA	CTD	PMID:26690555
Htr5a	Rat	raloxifene	affects expression	EXP		6480464	Raloxifene Hydrochloride affects the expression of HTR5A mRNA	CTD	PMID:16079270
Htr5a	Rat	rotenone	decreases expression	ISO	HTR5A (Homo sapiens)	6480464	Rotenone results in decreased expression of HTR5A mRNA	CTD	PMID:29955902
Htr5a	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of HTR5A mRNA	CTD	PMID:16644059
Htr5a	Rat	Theaflavin 3,3'-digallate	affects expression	ISO	HTR5A (Homo sapiens)	6480464	theaflavin-3 and 3'-digallate affects the expression of HTR5A mRNA	CTD	PMID:34925699
Htr5a	Rat	triptonide	increases expression	ISO	Htr5a (Mus musculus)	6480464	triptonide results in increased expression of HTR5A mRNA	CTD	PMID:33045310
Htr5a	Rat	troglitazone	increases expression	ISO	Htr5a (Mus musculus)	6480464	troglitazone results in increased expression of HTR5A mRNA	CTD	PMID:28973697
Htr5a	Rat	valproic acid	increases methylation	ISO	HTR5A (Homo sapiens)	6480464	Valproic Acid results in increased methylation of HTR5A gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Htr5a	Rat	adenylate cyclase-activating G protein-coupled receptor signaling pathway	acts_upstream_of_or_within	ISO	Htr5a (Mus musculus)	1624291	PMID:11406289	RGD	PMID:11406289
Htr5a	Rat	adenylate cyclase-activating G protein-coupled receptor signaling pathway	acts_upstream_of_or_within	IEA	UniProtKB:P30966 and ensembl:ENSMUSP00000038884	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Htr5a	Rat	adenylate cyclase-inhibiting serotonin receptor signaling pathway	involved_in	ISS	UniProtKB:P47898	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Htr5a	Rat	adenylate cyclase-inhibiting serotonin receptor signaling pathway	involved_in	IEA	UniProtKB:P47898 and ensembl:ENSP00000287907	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Htr5a	Rat	adenylate cyclase-inhibiting serotonin receptor signaling pathway	involved_in	ISO	HTR5A (Homo sapiens)	1624291	PMID:35610220 and PMID:9865521	RGD	PMID:35610220 and PMID:9865521
Htr5a	Rat	chemical synaptic transmission	involved_in	IBA	MGI:88398 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Htr5a	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR000276 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Htr5a	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Htr5a	Rat	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger		IMP		2316997		RGD
Htr5a	Rat	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	involved_in	IBA	PANTHER:PTN000664111 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Htr5a	Rat	hippocampus development		IEP		2316993		RGD
Htr5a	Rat	response to estradiol		IEP		1642579		RGD
Htr5a	Rat	signal transduction	involved_in	IEA	UniProtKB-KW:KW-0807	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Htr5a	Rat	dendrite		IDA		2316992		RGD
Htr5a	Rat	dendrite	is_active_in	IBA	PANTHER:PTN000664111 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Htr5a	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Htr5a	Rat	membrane	located_in	IEA	InterPro:IPR000276 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Htr5a	Rat	perikaryon		IDA		2316996		RGD
Htr5a	Rat	plasma membrane	is_active_in	ISS	UniProtKB:P47898	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Htr5a	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Htr5a	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Htr5a	Rat	plasma membrane	located_in	IEA	InterPro:IPR002231	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Htr5a	Rat	plasma membrane	is_active_in	IBA	FB:FBgn0000037 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Htr5a	Rat	plasma membrane	is_active_in	ISO	HTR5A (Homo sapiens)	1624291	PMID:9865521	RGD	PMID:9865521
Htr5a	Rat	plasma membrane	is_active_in	IEA	UniProtKB:P47898 and ensembl:ENSP00000287907	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Htr5a	Rat	postsynaptic specialization membrane	is_active_in	IDA		6480682	PMID:16082681	SynGO

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Htr5a	Rat	G protein-coupled receptor activity	enables	IEA	InterPro:IPR000276	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Htr5a	Rat	G protein-coupled receptor activity	enables	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Htr5a	Rat	G protein-coupled serotonin receptor activity		IMP		62385		RGD
Htr5a	Rat	G protein-coupled serotonin receptor activity	enables	IEA	InterPro:IPR001397 and InterPro:IPR002231	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Htr5a	Rat	G protein-coupled serotonin receptor activity	enables	IEA	UniProtKB:P47898 and ensembl:ENSP00000287907	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Htr5a	Rat	G protein-coupled serotonin receptor activity	enables	IBA	FB:FBgn0004168 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Htr5a	Rat	G protein-coupled serotonin receptor activity	enables	ISO	HTR5A (Homo sapiens)	1624291	PMID:7988681	RGD	PMID:7988681
Htr5a	Rat	Gi/o-coupled serotonin receptor activity	enables	ISS	UniProtKB:P47898	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Htr5a	Rat	Gi/o-coupled serotonin receptor activity	enables	IEA	UniProtKB:P47898 and ensembl:ENSP00000287907	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Htr5a	Rat	Gi/o-coupled serotonin receptor activity	enables	ISO	HTR5A (Homo sapiens)	1624291	PMID:35610220 more ...	RGD	PMID:35610220 more ...
Htr5a	Rat	neurotransmitter receptor activity	enables	IBA	FB:FBgn0000037 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Htr5a	Rat	serotonin receptor activity	enables	IEA	UniProtKB:P47898 and ensembl:ENSP00000287907	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Htr5a	Rat	serotonin receptor activity	enables	ISO	HTR5A (Homo sapiens)	1624291	PMID:9865521	RGD	PMID:9865521

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Htr5a	Rat	calcium/calcium-mediated signaling pathway		IEA		6907045		KEGG	rno:04020

#	Reference Title	Reference Citation
1.	5-HT5A receptor localization in the rat spinal cord suggests a role in nociception and control of pelvic floor musculature.	Doly S, etal., J Comp Neurol. 2004 Aug 30;476(4):316-29.
2.	Pre- and postsynaptic localization of the 5-HT7 receptor in rat dorsal spinal cord: immunocytochemical evidence.	Doly S, etal., J Comp Neurol. 2005 Sep 26;490(3):256-69.
3.	Two members of a distinct subfamily of 5-hydroxytryptamine receptors differentially expressed in rat brain.	Erlander MG, etal., Proc Natl Acad Sci U S A 1993 Apr 15;90(8):3452-6.
4.	Human neuronal changes in brain edema and increased intracranial pressure.	Faragó N, etal., Acta Neuropathol Commun. 2016 Aug 4;4(1):78. doi: 10.1186/s40478-016-0356-x.
5.	Ontogenetic distribution of 5-HT2C, 5-HT5A, and 5-HT7 receptors in the rat hippocampus.	Garcia-Alcocer G, etal., Gene Expr. 2006;13(1):53-7.
6.	Developmental expression of 5-HT 5A receptor mRNA in the rat brain.	Garcia-Alcocer G, etal., Neurosci Lett. 2005 May 6;379(2):101-5.
7.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.	Localization of 5-HT2A, 5-HT3, 5-HT5A and 5-HT7 receptor-like immunoreactivity in the rat cerebellum.	Geurts FJ, etal., J Chem Neuroanat 2002 Jun;24(1):65-74.
9.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
10.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	Estradiol induces expression of 5-hydroxytryptamine (5-HT) 4, 5-HT5, and 5-HT6 receptor messenger ribonucleic acid in rat anterior pituitary cell aggregates and allows prolactin release via the 5-HT4 receptor.	Papageorgiou A and Denef C, Endocrinology. 2007 Mar;148(3):1384-95. Epub 2006 Nov 22.
13.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
14.	GOA pipeline	RGD automated data pipeline
15.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
17.	Pertussis toxin treatment prevents 5-HT(5a) receptor-mediated inhibition of cyclic AMP accumulation in rat C6 glioma cells.	Thomas EA, etal., J Neurosci Res. 2000 Jul 1;61(1):75-81.
18.	Serotonin 5-HT2A and 5-HT5A receptors are expressed by different motoneuron populations in rat Onuf's nucleus.	Xu C, etal., J Comp Neurol. 2007 Jun 1;502(4):620-34.

PMID:7988681	PMID:11406289	PMID:20863873	PMID:26168890	PMID:33168874	PMID:38408524

Htr5a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	8,178,802 - 8,188,485 (-)	NCBI		GRCr8
mRatBN7.2	4	7,444,968 - 7,454,651 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	7,444,968 - 7,454,651 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	12,455,005 - 12,464,692 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	8,269,250 - 8,278,935 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	6,615,442 - 6,625,127 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	199,916 - 209,599 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	199,916 - 209,599 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	192,554 - 202,795 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	2,707,261 - 2,716,944 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	2,707,260 - 2,716,944 (-)	NCBI
Celera	4	2,826,290 - 2,835,975 (+)	NCBI		Celera
Cytogenetic Map	4	q11	NCBI

HTR5A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	155,070,324 - 155,087,392 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	155,070,324 - 155,087,392 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	154,862,034 - 154,879,102 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	154,493,479 - 154,508,392 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	154,300,257 - 154,313,845	NCBI
Celera	7	149,280,016 - 149,294,949 (+)	NCBI		Celera
Cytogenetic Map	7	q36.2	NCBI
HuRef	7	148,594,438 - 148,611,518 (+)	NCBI		HuRef
CHM1_1	7	154,870,423 - 154,887,497 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	156,245,922 - 156,265,002 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	154,090,358 - 154,107,446 (+)	NCBI

Htr5a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	28,046,836 - 28,059,403 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	28,047,147 - 28,060,086 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	27,841,716 - 27,855,086 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	27,842,149 - 27,855,088 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	28,168,487 - 28,181,626 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	28,172,734 - 28,185,873 (+)	NCBI		MGSCv36	mm8
Celera	5	25,390,567 - 25,404,062 (+)	NCBI		Celera
Cytogenetic Map	5	B1	NCBI
cM Map	5	13.24	NCBI

Htr5a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955491	8,257,698 - 8,267,817 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955491	8,258,032 - 8,266,503 (+)	NCBI	ChiLan1.0	ChiLan1.0

HTR5A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	191,499,178 - 191,516,265 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	43,509,446 - 43,526,531 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	146,672,908 - 146,690,001 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	158,399,874 - 158,416,922 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	158,399,874 - 158,416,922 (+)	Ensembl	panpan1.1		panPan2

HTR5A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	16	18,142,808 - 18,151,884 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	16	18,142,830 - 18,152,442 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	16	18,774,961 - 18,784,567 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	16	19,870,711 - 19,880,323 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	16	19,870,775 - 19,881,072 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	16	18,241,740 - 18,251,355 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	16	18,821,984 - 18,831,569 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	16	18,874,866 - 18,884,472 (+)	NCBI		UU_Cfam_GSD_1.0

Htr5a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	3,356,644 - 3,369,173 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936527	9,534,903 - 9,543,574 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936527	9,534,723 - 9,547,235 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HTR5A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	18	3,029,681 - 3,033,646 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	3,211,397 - 3,219,097 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HTR5A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	123,229,239 - 123,244,360 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	123,229,816 - 123,241,481 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666072	19,276,174 - 19,365,766 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Htr5a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624800	2,618,973 - 2,625,559 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624800	2,616,861 - 2,625,907 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Htr5a
92 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	76
Count of miRNA genes:	62
Interacting mature miRNAs:	69
Transcripts:	ENSRNOT00000009317
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61408	Scl23	Serum cholesterol level QTL 23		0.0005	blood HDL phospholipid amount (VT:0010504)	serum high density lipoprotein phospholipid level (CMO:0001567)	4	1	27716890	Rat
2302371	Stl22	Serum triglyceride level QTL 22	5.15		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	57114705	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
9589046	Scfw2	Subcutaneous fat weight QTL 2	5.54	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	4	1	31934116	Rat
8552903	Pigfal2	Plasma insulin-like growth factor 1 level QTL 2	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	1	31934116	Rat
724557	Plsm1	Polydactyly-luxate syndrome (PLS) morphotypes QTL 1		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	4	1	27716890	Rat
9590100	Sffal4	Serum free fatty acids level QTL 4	7.36	0.05	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	4	1	31934116	Rat
61351	Bp33	Blood pressure QTL 33		0.0018	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	1	27716890	Rat
61415	Eae11	Experimental allergic encephalomyelitis QTL 11	2.9		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	4	1	39505420	Rat
1641905	Colcr1	Colorectal carcinoma resistance QTL 1	4.3	0.0003	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	4	1	29494328	Rat
1357341	Gluco5	Glucose level QTL 5	6.4		adipocyte free fatty acid secretion trait (VT:0010465)	absolute change in adipocyte free fatty acid secretion per unit volume (CMO:0001446)	4	1	33250345	Rat
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5214602	78882945	Rat
1357343	Gluco4	Glucose level QTL 4		0.00002	adipocyte glucose uptake trait (VT:0004185)	adipocyte maximal glucose uptake to basal glucose uptake ratio (CMO:0000874)	4	1	33250345	Rat
1358201	Gluco12	Glucose level QTL12	1.6		adipocyte glucose uptake trait (VT:0004185)	adipocyte maximal glucose uptake (CMO:0000870)	4	5218392	29593287	Rat
738021	Hcar13	Hepatocarcinoma resistance QTL 13	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	4	1	32584199	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	65958103	Rat
631642	Stl2	Serum triglyceride level QTL 2	3.3		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5219178	56647776	Rat
61333	Gluco16	Glucose level QTL 16	4.3	0.00001	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	1	30372989	Rat
634323	Hc2	Hypercalciuria QTL 2	2.15		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	4	210796	45210796	Rat
9589097	Slep11	Serum leptin concentration QTL 11	5.09	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	4	1	31934116	Rat

RH94441

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	4	8,178,841 - 8,179,000 (+)	Marker Load Pipeline
mRatBN7.2	4	7,445,007 - 7,445,166 (-)	MAPPER	mRatBN7.2
Rnor_6.0	4	209,401 - 209,559	NCBI	Rnor6.0
Rnor_5.0	4	202,597 - 202,755	UniSTS	Rnor5.0
RGSC_v3.4	4	2,707,301 - 2,707,459	UniSTS	RGSC3.4
Celera	4	2,835,777 - 2,835,935	UniSTS
Cytogenetic Map	4	q11	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	reproductive system	respiratory system
8	6	97	23	20	7	6	7	6	37	22	85	27	13


RefSeq Transcripts	NM_013148	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474057	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L10072	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009317 ⟹ ENSRNOP00000009317

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	7,444,968 - 7,454,651 (-)	Ensembl
Rnor_6.0 Ensembl	4	199,916 - 209,599 (+)	Ensembl

RefSeq Acc Id:

NM_013148 ⟹ NP_037280

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	8,178,802 - 8,188,485 (-)	NCBI
mRatBN7.2	4	7,444,968 - 7,454,651 (-)	NCBI
Rnor_6.0	4	199,916 - 209,599 (+)	NCBI
Rnor_5.0	4	192,554 - 202,795 (+)	NCBI
RGSC_v3.4	4	2,707,261 - 2,716,944 (-)	RGD
Celera	4	2,826,290 - 2,835,975 (+)	RGD

Sequence:

show sequence

GGACTCTCACTGGGTGGAGACTGAGGTCAGGTTCTTGGCTCTTGGCAGAATCCTCTCCACTGGCCAGCGGTTGCAAACATCTAAATTGACTTCAGTGAACTCGGTGACTGCATTGAGTCTAAACGCAG
GTGTGCTGGGCCAGCAATGGATCTGCCTATAAACTTGACCTCCTTTTCTCTCTCTACTCCCTCCACTTTGGAACCTAACCGCAGCTTGGACACGGAAGCCCTGCGCACTAGTCAGTCTTTTCTCTCAG
CTTTCCGAGTGCTAGTCCTGACTTTGCTGGGCTTTCTAGCTGCCGCCACGTTCACTTGGAACCTGCTGGTGCTGGCCACCATCCTCAGGGTACGCACCTTCCACCGAGTACCACACAACCTGGTAGCA
TCCATGGCTATCTCGGATGTGCTAGTAGCTGTGCTGGTTATGCCTCTGAGCCTGGTACATGAACTGTCTGGGCGCCGCTGGCAGCTGGGCCGGCGTCTATGCCAGCTGTGGATTGCGTGTGACGTCCT
CTGCTGTACTGCCAGCATCTGGAATGTGACAGCAATAGCTTTGGACCGCTACTGGTCAATAACGCGCCACCTGGAGTACACACTCCGTGCCCGCAAGCGTGTCTCCAACGTGATGATCCTGCTCACTT
GGGCACTCTCCGCTGTCATCTCTCTGGCTCCGCTGCTCTTTGGCTGGGGAGAGACTTACTCGGAGCTCAGTGAAGAATGCCAGGTCAGTCGCGAGCCTTCCTACACCGTGTTCTCCACTGTGGGCGCC
TTCTACCTGCCGCTGTGTGTGGTGCTCTTTGTATACTGGAAGATTTACAAGGCTGCGAAGTTCCGCATGGGCTCCAGGAAGACCAACAGCGTCTCCCCCATACCTGAAGCTGTGGAGGTGAAGGACGC
TTCACAACATCCCCAGATGGTGTTCACTGTCCGTCACGCCACCGTCACCTTCCAGACAGAAGGGGACACGTGGAGGGAACAGAAGGAGCAAAGGGCAGCCCTCATGGTGGGCATCCTCATTGGGGTGT
TTGTCCTCTGCTGGTTCCCCTTCTTTGTTACGGAGCTCATCAGTCCGCTGTGCTCCTGGGATATCCCTGCCCTCTGGAAGAGCATCTTCCTGTGGCTGGGCTATTCCAACTCCTTCTTCAACCCGCTC
ATCTACACGGCGTTCAACAGGAGCTACAGCAGTGCTTTTAAGGTCTTCTTCTCCAAGCAGCAGTGAGAGGCCACATGGGAGTGCCTTCTTCCCGTAGCTTGTAGCTCGGTGGACTGTCCTGCCTCACA
AACCCCTGTAGTCTGCCCAGCTGTCCAGAGGAACAAGATCCATCTGCCAAGGGCACCAGGGTCACATCAGAGCTCAGCTCACTTCAGTTCTGTGCCCGTGTGCTGGAAGGTGTCTCCTATAGGCTCTG
GTAGCTTGTGTCCCCAGTCTGGGCACTCTTCCTCACACTGTACCAGCAGCCACAGGCCTGGCCCACAACGTGCCCATTTCTCCTCCAACTCCACTCCAGCGGGACCATGAGAAGTTTGATCAGAACGA
ACAGGAGGAAGGAAGAGAGACAATAAGGCAGGCAGAGAGAGGCAGAAAGAACAAGGCTGAAAGCCAGTGGGATCACATACCTGGAACCCTCACACCAAGGAGACTTAGGCAGGTAGAACAGGAATTTG
GAGCCATCCTGGGCTACATAGTAAGTTCATAAATCAGTCTGAGCTGTCTGACACAGACTTAGCAACAGCAATGCACTAGAGAGGCTATTTGAAAAGCAGAGACCATAAGGGCAAACTTCCATAACAGC
CTCACTTCACAGTTCTGCTCTGTGGTCCTGCAGTGTATGGCCCAATTCTGGGTCCTTCTGAATATCTGATCACAAGATTCTGTCCCCAAACATATCAAAGCACCATCCCATTTGTGATAACAGTGATT
CCTGTCTTTACCATTTGTTCATTGTGAACCCAAA

hide sequence


Protein RefSeqs	NP_037280	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40615	(Get FASTA)	NCBI Sequence Viewer
	EDL86411	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009317.1
GenBank Protein	P35364	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_037280 ⟸ NM_013148

- UniProtKB:

P35364 (UniProtKB/Swiss-Prot), A6KJK9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDLPINLTSFSLSTPSTLEPNRSLDTEALRTSQSFLSAFRVLVLTLLGFLAAATFTWNLLVLATILRVRTFHRVPHNLVASMAISDVLVAVLVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTAS
IWNVTAIALDRYWSITRHLEYTLRARKRVSNVMILLTWALSAVISLAPLLFGWGETYSELSEECQVSREPSYTVFSTVGAFYLPLCVVLFVYWKIYKAAKFRMGSRKTNSVSPIPEAVEVKDASQHPQ
MVFTVRHATVTFQTEGDTWREQKEQRAALMVGILIGVFVLCWFPFFVTELISPLCSWDIPALWKSIFLWLGYSNSFFNPLIYTAFNRSYSSAFKVFFSKQQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000009317 ⟸ ENSRNOT00000009317

Protein Domains

G-protein coupled receptors family 1 profile

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P35364-F1-model_v2	AlphaFold	P35364	1-357	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-46128	BioCyc
Ensembl Genes	ENSRNOG00000007066	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000009317.3	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	5HT5A_rcpt	UniProtKB/Swiss-Prot
	5HT_rcpt	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
KEGG Report	rno:25689	UniProtKB/Swiss-Prot
NCBI Gene	25689	ENTREZGENE
PANTHER	5-HYDROXYTRYPTAMINE RECEPTOR 5A	UniProtKB/Swiss-Prot
	ADRENERGIC RECEPTOR-RELATED G-PROTEIN COUPLED RECEPTOR	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PharmGKB	HTR5A	RGD
PhenoGen	Htr5a	PhenoGen
PRINTS	5HT5ARECEPTR	UniProtKB/Swiss-Prot
	5HTRECEPTOR	UniProtKB/Swiss-Prot
	GPCRRHODOPSN	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000007066	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	5HT5A_RAT	UniProtKB/Swiss-Prot
	A6KJK9	ENTREZGENE, UniProtKB/TrEMBL
	P35364	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-11	Htr5a	5-hydroxytryptamine receptor 5A	Htr5a	5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-17	Htr5a	5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled	Htr5a	5-hydroxytryptamine (serotonin) receptor 5A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Htr5a	5-hydroxytryptamine (serotonin) receptor 5A			Symbol and Name status set to approved	70586	APPROVED

Note Type	Note	Reference
gene_expression	expressed in Purkinje cells, molecular layer interneurons and Golgi cells	727384

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)