Gipr (gastric inhibitory polypeptide receptor)

Advanced Search (OLGA)

Gene: Gipr (gastric inhibitory polypeptide receptor) Rattus norvegicus

Analyze

Symbol:

Gipr

Name:

gastric inhibitory polypeptide receptor

RGD ID:

2689

Description:

Enables gastric inhibitory peptide receptor activity and peptide hormone binding activity. Involved in several processes, including desensitization of G protein-coupled receptor signaling pathway; gastric inhibitory peptide signaling pathway; and positive regulation of insulin secretion. Predicted to be active in plasma membrane. Used to study type 2 diabetes mellitus. Biomarker of hyperglycemia. Human ortholog(s) of this gene implicated in cardiovascular system disease; diabetes mellitus; and obesity. Orthologous to human GIPR (gastric inhibitory polypeptide receptor); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

gastric inhibitory peptide receptor; GIP-R; Gippr; glucose-dependent insulinotropic polypeptide receptor; RATGIPPR

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	87,932,316 - 87,956,084 (-)	NCBI		GRCr8
mRatBN7.2	1	78,804,287 - 78,814,462 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	78,805,593 - 78,814,462 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	84,193,315 - 84,203,481 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	92,750,951 - 92,761,121 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	85,948,417 - 85,958,584 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	80,063,047 - 80,073,223 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	80,063,049 - 80,073,223 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	81,329,939 - 81,340,229 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	78,515,051 - 78,526,160 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	78,593,161 - 78,604,271 (-)	NCBI
Celera	1	73,269,949 - 73,280,124 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Body Weight (ISO)

cardiovascular system disease (ISO)

diabetes mellitus (ISO)

Diabetic Nephropathies (ISO)

Experimental Diabetes Mellitus (IEP)

glucose intolerance (ISO)

hyperglycemia (IEP,ISO)

lung non-small cell carcinoma (ISO)

obesity (ISO)

type 2 diabetes mellitus (IAGP,ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3',5'-cyclic AMP (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

actinomycin D (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (EXP)

camptothecin (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

dichlorine (EXP)

flavonoids (EXP)

fulvestrant (ISO)

furan (EXP)

glycidol (EXP)

methylisothiazolinone (ISO)

N-methyl-4-phenylpyridinium (ISO)

Nutlin-3 (ISO)

ozone (EXP)

potassium dichromate (ISO)

rotenone (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sotorasib (ISO)

sunitinib (ISO)

thioacetamide (EXP)

trametinib (ISO)

trichostatin A (ISO)

triclosan (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating G protein-coupled receptor signaling pathway (ISO)

adenylate cyclase-modulating G protein-coupled receptor signaling pathway (IBA)

cell surface receptor signaling pathway (IEA)

desensitization of G protein-coupled receptor signaling pathway (IDA)

endocrine pancreas development (ISO)

gastric inhibitory peptide signaling pathway (IEA,IMP,ISO)

positive regulation of cytosolic calcium ion concentration (IDA)

positive regulation of insulin secretion (IMP,ISO)

response to axon injury (IEP)

response to calcium ion (IMP)

response to fatty acid (IEP)

response to glucose (IEP)

Cellular Component

plasma membrane (IBA,IEA,ISO)

Molecular Function

G protein-coupled peptide receptor activity (IBA)

gastric inhibitory peptide receptor activity (IBA,IDA,IEA,ISO)

glucagon family peptide binding (ISO)

peptide hormone binding (IBA,IPI,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Sp1/Sp3 binding is associated with cell-specific expression of the glucose-dependent insulinotropic polypeptide receptor gene.	Boylan MO, etal., Am J Physiol Endocrinol Metab. 2006 Jun;290(6):E1287-95. Epub 2006 Jan 10.
2.	Glucose-dependent insulinotropic polypeptide (GIP) and its receptor (GIPR): cellular localization, lesion-affected expression, and impaired regenerative axonal growth.	Buhren BA, etal., J Neurosci Res. 2009 Jun;87(8):1858-70.
3.	Upregulation of glucose-dependent insulinotropic polypeptide and its receptor in the retina of streptozotocin-induced diabetic rats.	Cho GJ, etal., Curr Eye Res. 2002 Dec;25(6):381-8.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	A novel GIP receptor splice variant influences GIP sensitivity of pancreatic beta-cells in obese mice.	Harada N, etal., Am J Physiol Endocrinol Metab. 2008 Jan;294(1):E61-8. Epub 2007 Oct 30.
7.	Diabetic kidney lesions of GIPRdn transgenic mice: podocyte hypertrophy and thickening of the GBM precede glomerular hypertrophy and glomerulosclerosis.	Herbach N, etal., Am J Physiol Renal Physiol. 2009 Apr;296(4):F819-29. Epub 2009 Feb 11.
8.	Overexpression of a dominant negative GIP receptor in transgenic mice results in disturbed postnatal pancreatic islet and beta-cell development.	Herbach N, etal., Regul Pept. 2005 Feb 15;125(1-3):103-17.
9.	Ultrastructural identification of neurofibrillary tangles in the spinal cords in Guamanian amyotrophic lateral sclerosis and parkinsonism-dementia complex on Guam.	Kato S, etal., Acta Neuropathol. 1992;83(3):277-82.
10.	Glucose-dependent insulinotropic polypeptide confers early phase insulin release to oral glucose in rats: demonstration by a receptor antagonist.	Lewis JT, etal., Endocrinology. 2000 Oct;141(10):3710-6.
11.	Defective glucose-dependent insulinotropic polypeptide receptor expression in diabetic fatty Zucker rats.	Lynn FC, etal., Diabetes 2001 May;50(5):1004-11.
12.	A novel pathway for regulation of glucose-dependent insulinotropic polypeptide (GIP) receptor expression in beta cells.	Lynn FC, etal., FASEB J 2003 Jan;17(1):91-3.
13.	Inhibition of gastric inhibitory polypeptide signaling prevents obesity.	Miyawaki K, etal., Nat Med 2002 Jul;8(7):738-42.
14.	Glucose intolerance caused by a defect in the entero-insular axis: a study in gastric inhibitory polypeptide receptor knockout mice.	Miyawaki K, etal., Proc Natl Acad Sci U S A 1999 Dec 21;96(26):14843-7.
15.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
16.	Association analyses of GIP and GIPR polymorphisms with traits of the metabolic syndrome.	Nitz I, etal., Mol Nutr Food Res. 2007 Aug;51(8):1046-52.
17.	GOA pipeline	RGD automated data pipeline
18.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
19.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
20.	GIP receptor mRNA expression in different fat tissue depots in postmenopausal non-diabetic women.	Rudovich N, etal., Regul Pept. 2007 Aug 16;142(3):138-45. Epub 2007 Feb 23.
21.	Decreased TCF7L2 protein levels in type 2 diabetes mellitus correlate with downregulation of GIP- and GLP-1 receptors and impaired beta-cell function.	Shu L, etal., Hum Mol Genet. 2009 Jul 1;18(13):2388-99. Epub 2009 Apr 21.
22.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
23.	The cysteine of the cytoplasmic tail of glucose-dependent insulinotropic peptide receptor mediates its chronic desensitization and down-regulation.	Tseng CC and Zhang XY, Mol Cell Endocrinol. 1998 Apr 30;139(1-2):179-86.
24.	Chronic desensitization of the glucose-dependent insulinotropic polypeptide receptor in diabetic rats.	Tseng CC, etal., Am J Physiol. 1996 Apr;270(4 Pt 1):E661-6.
25.	Postprandial stimulation of insulin release by glucose-dependent insulinotropic polypeptide (GIP). Effect of a specific glucose-dependent insulinotropic polypeptide receptor antagonist in the rat.	Tseng CC, etal., J Clin Invest. 1996 Dec 1;98(11):2440-5.
26.	Gastric inhibitory polypeptide receptor, a member of the secretin-vasoactive intestinal peptide receptor family, is widely distributed in peripheral organs and the brain.	Usdin TB, etal., Endocrinology 1993 Dec;133(6):2861-70.
27.	Gastric inhibitory polypeptide receptor: association analyses for obesity of several polymorphisms in large study groups.	Vogel CI, etal., BMC Med Genet. 2009 Mar 2;10:19.
28.	Ubiquitination is involved in glucose-mediated downregulation of GIP receptors in islets.	Zhou J, etal., Am J Physiol Endocrinol Metab. 2007 Aug;293(2):E538-47. Epub 2007 May 15.

Additional References at PubMed

PMID:15716418	PMID:17360984	PMID:17803965	PMID:20332343	PMID:21270265	PMID:22778220	PMID:23689510	PMID:24360021	PMID:26395740	PMID:33321289	PMID:34607331

Genomics

Comparative Map Data

Gipr
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	87,932,316 - 87,956,084 (-)	NCBI		GRCr8
mRatBN7.2	1	78,804,287 - 78,814,462 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	78,805,593 - 78,814,462 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	84,193,315 - 84,203,481 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	92,750,951 - 92,761,121 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	85,948,417 - 85,958,584 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	80,063,047 - 80,073,223 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	80,063,049 - 80,073,223 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	81,329,939 - 81,340,229 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	78,515,051 - 78,526,160 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	78,593,161 - 78,604,271 (-)	NCBI
Celera	1	73,269,949 - 73,280,124 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

GIPR
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	45,668,221 - 45,683,722 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	45,668,221 - 45,683,722 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	46,171,479 - 46,186,980 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	50,863,342 - 50,877,557 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	50,863,341 - 50,877,557	NCBI
Celera	19	42,977,625 - 42,991,837 (+)	NCBI		Celera
Cytogenetic Map	19	q13.32	NCBI
HuRef	19	42,600,524 - 42,614,679 (+)	NCBI		HuRef
CHM1_1	19	46,174,972 - 46,189,186 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	48,495,760 - 48,511,255 (+)	NCBI		T2T-CHM13v2.0

Gipr
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	18,889,988 - 18,904,173 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	18,889,986 - 18,900,052 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	19,156,063 - 19,170,248 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	19,156,061 - 19,166,127 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	19,742,474 - 19,751,476 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	18,315,453 - 18,324,649 (-)	NCBI		MGSCv36	mm8
Celera	7	16,568,476 - 16,578,046 (-)	NCBI		Celera
Cytogenetic Map	7	A3	NCBI
cM Map	7	9.46	NCBI

Gipr
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955574	140,307 - 156,899 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955574	140,307 - 153,684 (+)	NCBI	ChiLan1.0	ChiLan1.0

GIPR
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	51,831,009 - 51,845,310 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	53,702,530 - 53,716,790 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	42,673,553 - 42,688,059 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	51,213,090 - 51,225,293 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	51,213,090 - 51,225,293 (+)	Ensembl	panpan1.1		panPan2

GIPR
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	109,898,617 - 109,909,331 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	109,899,874 - 109,909,410 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	109,383,520 - 109,394,464 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	110,431,638 - 110,442,592 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	110,431,641 - 110,441,388 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	110,107,193 - 110,118,149 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	109,741,834 - 109,752,781 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	110,610,695 - 110,621,654 (-)	NCBI		UU_Cfam_GSD_1.0

Gipr
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	17,697,897 - 17,715,171 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936706	2,053,433 - 2,061,241 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936706	2,052,069 - 2,062,722 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GIPR
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	52,022,681 - 52,033,954 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	52,022,667 - 52,033,959 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

GIPR
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	39,108,319 - 39,122,973 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	39,110,387 - 39,122,874 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	18,735,245 - 18,751,098 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gipr
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	7,497,258 - 7,507,212 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624832	7,497,147 - 7,507,123 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gipr
30 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	443
Count of miRNA genes:	236
Interacting mature miRNAs:	291
Transcripts:	ENSRNOT00000021456
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	53895117	82174945	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	72197680	90508767	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	53895117	82174945	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	78430754	91209302	Rat

Markers in Region

D1Wox30

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	78,804,569 - 78,804,684 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	80,063,332 - 80,063,446	NCBI	Rnor6.0
Rnor_5.0	1	81,330,224 - 81,330,338	UniSTS	Rnor5.0
RGSC_v3.4	1	78,515,333 - 78,515,448	RGD	RGSC3.4
RGSC_v3.4	1	78,515,334 - 78,515,448	UniSTS	RGSC3.4
RGSC_v3.1	1	78,593,444 - 78,593,559	RGD
Celera	1	73,270,232 - 73,270,346	UniSTS
RH 3.4 Map	1	789.0	RGD
RH 3.4 Map	1	789.0	UniSTS
Cytogenetic Map	1	q21	UniSTS

RH144450

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	78,804,500 - 78,804,725 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	80,063,263 - 80,063,487	NCBI	Rnor6.0
Rnor_5.0	1	81,330,155 - 81,330,379	UniSTS	Rnor5.0
RGSC_v3.4	1	78,515,265 - 78,515,489	UniSTS	RGSC3.4
Celera	1	73,270,163 - 73,270,387	UniSTS
RH 3.4 Map	1	812.5	UniSTS
Cytogenetic Map	1	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	9	44	113	70	69	38	25	38	6	189	91	93	44	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012714	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017588800	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281146	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC120692	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF050667	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L19660	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000021456 ⟹ ENSRNOP00000021456

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	78,805,593 - 78,814,462 (-)	Ensembl
Rnor_6.0 Ensembl	1	80,063,049 - 80,073,223 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112788 ⟹ ENSRNOP00000081882

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	78,805,593 - 78,814,462 (-)	Ensembl

RefSeq Acc Id:

NM_012714 ⟹ NP_036846

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	87,932,318 - 87,942,492 (-)	NCBI
mRatBN7.2	1	78,804,287 - 78,814,462 (-)	NCBI
Rnor_6.0	1	80,063,049 - 80,073,223 (-)	NCBI
Rnor_5.0	1	81,329,939 - 81,340,229 (-)	NCBI
RGSC_v3.4	1	78,515,051 - 78,526,160 (-)	RGD
Celera	1	73,269,949 - 73,280,124 (-)	RGD

Sequence:

show sequence

AGAGCTCTCTGGCAGGCGAGGCAGGGCAGCTGTTTCAGTGGAGATTGCGAGCAGGACTCGGTAC
AGGTGAGCACTGACTTGGGCTGAAGCTCAAGAGTTGGTTCTGCCCGGGGACCCTCCAGCCCAAC
TGCCTCGAGTGGCCAGAGTCTCCAATCACCTTTCAAGGATGCCCCTGCGGCTGTTGCTTCTGCT
GCTGTGGCTCTGGGGATTGTCACTCCAGAGGGCGGAGACAGATTCTGAGGGGCAGACGACGGGA
GAGCTGTACCAGCGCTGGGAGCGTTACGGCTGGGAATGCCAAAACACCTTGGAGGCCACAGAAC
CTCCCTCAGGCCTGGCCTGTAATGGTTCCTTCGATATGTATGCCTGCTGGAACTACACGGCTGC
CAACACCACTGCCCGGGTGTCCTGCCCCTGGTATCTGCCCTGGTACCGCCAGGTGGCTGCAGGC
TTCGTCTTCCGCCAGTGTGGTAGTGATGGCCAATGGGGATCTTGGAGAGACCACACTCAATGTG
AGAATCCAGAGAAGAATGGGGCCTTTCAGGACCAGAAGCTGATCTTGGAGCGCCTGCAGGTCGT
GTATACAGTCGGCTACTCCCTGTCCCTGGCCACTCTGCTGCTAGCCCTACTCATTTTAAGTTTG
TTCAGGCGGCTTCACTGCACTCGTAATTACATTCACATGAACCTGTTCACGTCTTTCATGCTGC
GAGCAGGGGCCATCCTCACCCGAGACCAGCTGCTGCCTCCACTGGGTCCCTACACGGGAAACCA
GACCCCTACCCTGTGGAACCAGGCCCTAGCTGCCTGCCGCACAGCCCAGATCTTGACCCAGTAC
TGTGTGGGAGCCAATTACACCTGGCTGCTGGTGGAGGGTGTGTATCTGCACCATCTGCTGGTGG
TTGTGAGACGCTCAGAAAAGGGCCACTTCCGCTGCTACCTGCTTCTTGGCTGGGGGGCCCCCGC
GCTTTTCGTCATCCCCTGGGTGATCGTCAGGTACCTGTACGAGAACACGCAGTGCTGGGAGCGC
AACGAAGTCAAAGCCATTTGGTGGATCATTCGCACCCCCATCCTAATAACCATCTTGATCAATT
TCCTCATCTTTATCCGCATCCTTGGCATCCTTGTTTCAAAGCTGAGGACTCGACAGATGCGCTG
TCCCGACTACCGACTAAGGCTGGCTCGCTCCACGCTGACACTGATGCCCCTGCTGGGTGTCCAC
GAGGTGGTATTTGCTCCCGTGACCGAGGAACAGGCTGAAGGCTCCCTGCGCTTTGCCAAACTGG
CCTTTGAAATCTTCTTAAGTTCCTTCCAGGGTTTCCTCGTGAGTGTGCTCTACTGCTTCATCAA
CAAAGAGGTACAGTCGGAGATCCGCCGTCTGCGTCTCAGCCTTCAGGAACAGTGTCCACGTCCG
CACCTGGGGCAGGCCCCCCGGGCGGTGCCTTTGAGCTCTGCACCCCAGGAAGCTGCCATCCGCA
ATGCCTTGCCCTCTGGGATGCTGCATGTGCCTGGAGATGAGGTCTTGGAAAGTTACTGCTAGGA
CAACCGACTGGGAGGCCACTTGCGAAGACATGATGGGACATGTTTGGGAGAGTGGAGACAGCTT
GAAGAGTTGGAGGATAAGATTCCAGGCAGACGGAACAGCACAGGAAAAGGTCCTGGGAACAGGA
AGAATGGAGAAAGACTTCCATGGTCCCACTGGAAAAAGCCAGGGCCTGCAGATGGGGAAGGAGT
GGGCAGGGGGTGCAGAAACTGGAATTTCACCGCAGGCTCACTGAAGATTTTATTTTTACTTTTA
CGTGTACAATTGCTTTGCCTGTGTATACGGATGGATACCACATGCATACAGTGTTTGCATATGC
CAGAGGACAGAAGATCTCTGGGACCGAATGCTTGTCAGCCTTTATGTAGATGAAGTGAACACAA
CTCCATCTCTCCAGTCCCACACAGATTTTAGCAGCAGTGTCTCCTGGGCTGTTTCCATGGCTCT
CTGTTCTAGGGACTAGGGGCAGTGAGTTGGGAGCCCAGTGAGAGGAATGCAGGTGGCTGGACCA
GAATGGAGGCCACAGAGAGGTGGGAAGGATTTGCTGAGGGGTCCCAGGAGAGGGATCAAAGGAG
ACAGTCAAGACAAAAGGAGAGCAATCAAAAGTCAAAAGGCTCTGTGGTGTGGGAGGCTCTGCTG
TGCCAGGCTGTGAGAGATGAGCAGCAGGACCTGGAGCTGTAGGTGGTGAGAGCTGGCAGCCAAG
CAAGAGGATCCTGTGGTCAGTGGAGGTAGCCAGATCTTCCCACCTCCCAGAGAGGGTTGGGGAT
GAAGCCTCATTGTGACTGGTCCACCTGTGGATGGATGGACACACAGACACACACACACACACAC
AGAGGCCTCCTTTATCAGTACTGGGTGCTGTGTTTCCCCAGGGTTCCCAGAAAGATGTGTCTCC
TAGCTGACCCCGCACTCAACACTTCAGGGCTTTGCCTTCTGGAGTGGAGACTCTAGTAAATTAA
GCTTCTTTATGGGGTGGGAGGCTAGGCTAGAAAGGGAGATGACTAGGGTGTGTGTGAGGTAGTC
TGCCATAGATCAATGAGGCTCATTTGGAGCCATATGTTGGCACAAAAAACCATGGACACCACAT
TGCTACTGTACCCTCCCCTAAGATAACCTTTATTGAGAACTAAGACATATGTACAAATTAAAGT
TGTGTGTGTG

hide sequence

RefSeq Acc Id:

XM_063281146 ⟹ XP_063137216

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	87,932,316 - 87,956,084 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_036846	(Get FASTA)	NCBI Sequence Viewer
	XP_063137216	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC37637	(Get FASTA)	NCBI Sequence Viewer
	EDM08230	(Get FASTA)	NCBI Sequence Viewer
	EDM08231	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021456.1
	ENSRNOP00000081882.1
	ENSRNOP00055046687
	ENSRNOP00060047148
	ENSRNOP00065047999
GenBank Protein	P43219	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_036846 ⟸ NM_012714
- Peptide Label:	precursor
- UniProtKB:	P43219 (UniProtKB/Swiss-Prot), A6J8K3 (UniProtKB/TrEMBL), A0A8I5ZT57 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPLRLLLLLLWLWGLSLQRAETDSEGQTTGELYQRWERYGWECQNTLEATEPPSGLACNGSFDM YACWNYTAANTTARVSCPWYLPWYRQVAAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQK LILERLQVVYTVGYSLSLATLLLALLILSLFRRLHCTRNYIHMNLFTSFMLRAGAILTRDQLLP PLGPYTGNQTPTLWNQALAACRTAQILTQYCVGANYTWLLVEGVYLHHLLVVVRRSEKGHFRCY LLLGWGAPALFVIPWVIVRYLYENTQCWERNEVKAIWWIIRTPILITILINFLIFIRILGILVS KLRTRQMRCPDYRLRLARSTLTLMPLLGVHEVVFAPVTEEQAEGSLRFAKLAFEIFLSSFQGFL VSVLYCFINKEVQSEIRRLRLSLQEQCPRPHLGQAPRAVPLSSAPQEAAIRNALPSGMLHVPGD EVLESYC hide sequence

Ensembl Acc Id:

ENSRNOP00000021456 ⟸ ENSRNOT00000021456

Ensembl Acc Id:

ENSRNOP00000081882 ⟸ ENSRNOT00000112788

RefSeq Acc Id:	XP_063137216 ⟸ XM_063281146
- Peptide Label:	isoform X1
- UniProtKB:	P43219 (UniProtKB/Swiss-Prot), A6J8K3 (UniProtKB/TrEMBL)

Protein Domains

G-protein coupled receptors family 2 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P43219-F1-model_v2	AlphaFold	P43219	1-455	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2689	AgrOrtholog
BioCyc Gene	G2FUF-60527	BioCyc
Ensembl Genes	ENSRNOG00000015860	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055032729	UniProtKB/Swiss-Prot
	ENSRNOG00060032915	UniProtKB/Swiss-Prot
	ENSRNOG00065033957	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000021456.3	UniProtKB/Swiss-Prot
	ENSRNOT00000112788.1	UniProtKB/TrEMBL
	ENSRNOT00055056580	UniProtKB/Swiss-Prot
	ENSRNOT00060057068	UniProtKB/Swiss-Prot
	ENSRNOT00065058323	UniProtKB/Swiss-Prot
Gene3D-CATH	4.10.1240.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	GPCR_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_2-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_2_extracell_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_2_extracellular_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_2_GIP_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_2_secretin-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_2_secretin-like_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25024	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	25024	ENTREZGENE
PANTHER	GASTRIC INHIBITORY POLYPEPTIDE RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PDF RECEPTOR-LIKE PROTEIN-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HRM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Gipr	PhenoGen
PRINTS	GIPRECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCRSECRETIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F2_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F2_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F2_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F2_4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000015860	RatGTEx
	ENSRNOG00055032729	RatGTEx
	ENSRNOG00060032915	RatGTEx
	ENSRNOG00065033957	RatGTEx
SMART	HormR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF111418	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC220766
UniProt	A0A8I5ZT57	ENTREZGENE, UniProtKB/TrEMBL
	A6J8K3	ENTREZGENE, UniProtKB/TrEMBL
	GIPR_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Gipr	gastric inhibitory polypeptide receptor		gastric inhibitory peptide receptor	Name updated	1299863	APPROVED
2002-06-10	Gipr	gastric inhibitory peptide receptor			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_disease	may be associated with type 2 diabetes	68929
gene_disease	decreased mRNA and protein expression is detected in pancreatic islets of the Vancouver diabetic fatty Zucker rat	68929
gene_function	receptor for GIP (gastric inhibitory peptide)	68929
gene_process	potentiates glucose-induced insulin secretion from the pancreatic beta cells	68929

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD