Alkbh7 (alkB homolog 7) - Rat Genome Database

Name: Alkbh7
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Alkbh7 (alkB homolog 7) Rattus norvegicus

Analyze

Symbol:

Alkbh7

Name:

alkB homolog 7

RGD ID:

1598126

Description:

Predicted to be involved in several processes, including fatty acid metabolic process; regulation of lipid storage; and regulation of mitochondrial membrane permeability involved in programmed necrotic cell death. Predicted to be located in mitochondrion. Predicted to be active in mitochondrial matrix. Orthologous to human ALKBH7 (alkB homolog 7); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

alkB, alkylation repair homolog 7; alkB, alkylation repair homolog 7 (E. coli); AlkB-like protein 7; alkylated DNA repair protein alkB homolog 7; alpha-ketoglutarate-dependent dioxygenase alkB homolog 7, mitochondrial; LOC679944; similar to spermatogenesis associated 11

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ALKBH7 (alkB homolog 7)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Alkbh7 (alkB homolog 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Alkbh7 (alkB homolog 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ALKBH7 (alkB homolog 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ALKBH7 (alkB homolog 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Alkbh7 (alkB homolog 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ALKBH7 (alkB homolog 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ALKBH7 (alkB homolog 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Alkbh7 (alkB homolog 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ALKBH7 (alkB homolog 7)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Alkbh7 (alkB homolog 7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	alkbh7 (alkB homolog 7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG14130	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	alkb-7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	alkbh7	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	1,925,896 - 1,928,048 (+)	NCBI		GRCr8
mRatBN7.2	9	1,838,886 - 1,841,044 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	1,838,811 - 1,841,044 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	2,272,791 - 2,274,925 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	7,622,150 - 7,624,284 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	6,578,011 - 6,580,146 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	10,045,375 - 10,047,507 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	10,045,375 - 10,047,507 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	9,046,025 - 9,048,175 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	9	6,676,245 - 6,678,377 (-)	NCBI		Celera
Cytogenetic Map	9	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

mucolipidosis type IV (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (EXP)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

amiodarone (EXP)

amitrole (EXP)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP,ISO)

buspirone (EXP)

carbon nanotube (ISO)

chrysene (ISO)

cisplatin (ISO)

clofibrate (EXP)

coumestrol (ISO)

dibutyl phthalate (ISO)

epoxiconazole (ISO)

fluoranthene (ISO)

ivermectin (ISO)

ketoconazole (EXP)

L-ethionine (EXP)

lead(0) (ISO)

methimazole (EXP)

nefazodone (EXP)

nickel atom (ISO)

niclosamide (ISO)

nitrofen (EXP)

omeprazole (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

pirinixic acid (EXP)

quercitrin (ISO)

rac-lactic acid (ISO)

silver atom (ISO)

silver(0) (ISO)

temozolomide (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

DNA damage response (ISO)

fatty acid metabolic process (IBA,ISO)

regulation of lipid storage (ISO)

regulation of mitochondrial membrane permeability involved in programmed necrotic cell death (ISO)

Cellular Component

mitochondrial matrix (IBA,ISO)

mitochondrion (ISO)

Molecular Function

2-oxoglutarate-dependent dioxygenase activity (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:16174769	PMID:18614015	PMID:23572141	PMID:23666923

Genomics

Comparative Map Data

Alkbh7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	1,925,896 - 1,928,048 (+)	NCBI		GRCr8
mRatBN7.2	9	1,838,886 - 1,841,044 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	1,838,811 - 1,841,044 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	2,272,791 - 2,274,925 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	7,622,150 - 7,624,284 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	6,578,011 - 6,580,146 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	10,045,375 - 10,047,507 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	10,045,375 - 10,047,507 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	9,046,025 - 9,048,175 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	9	6,676,245 - 6,678,377 (-)	NCBI		Celera
Cytogenetic Map	9	q11	NCBI

ALKBH7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	6,372,794 - 6,375,250 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	6,372,794 - 6,375,250 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	6,372,805 - 6,375,261 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	6,323,444 - 6,326,040 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	6,323,443 - 6,326,040	NCBI
Celera	19	6,311,231 - 6,314,048 (+)	NCBI		Celera
Cytogenetic Map	19	p13.3	NCBI
HuRef	19	6,132,589 - 6,135,406 (+)	NCBI		HuRef
CHM1_1	19	6,372,069 - 6,374,886 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	6,361,696 - 6,364,152 (+)	NCBI		T2T-CHM13v2.0

Alkbh7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	57,304,339 - 57,306,340 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	57,304,339 - 57,306,322 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	56,997,339 - 56,999,340 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	56,997,339 - 56,999,322 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	57,136,776 - 57,138,745 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	56,682,477 - 56,684,446 (+)	NCBI		MGSCv36	mm8
Celera	17	61,345,279 - 61,347,248 (+)	NCBI		Celera
Cytogenetic Map	17	D	NCBI
cM Map	17	29.61	NCBI

Alkbh7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955495	3,220,994 - 3,223,551 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955495	3,220,994 - 3,222,675 (-)	NCBI	ChiLan1.0	ChiLan1.0

ALKBH7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	10,770,082 - 10,775,706 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	9,999,342 - 10,001,637 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	5,393,317 - 5,395,886 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	6,315,604 - 6,318,174 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	6,315,604 - 6,318,170 (+)	Ensembl	panpan1.1		panPan2

ALKBH7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	53,783,948 - 53,785,563 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	53,783,993 - 53,785,524 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	53,530,856 - 53,532,460 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	54,438,215 - 54,439,821 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	54,438,223 - 54,439,826 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	53,504,678 - 53,506,283 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	53,953,017 - 53,954,622 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	54,182,768 - 54,184,373 (-)	NCBI		UU_Cfam_GSD_1.0

Alkbh7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	214,100,011 - 214,101,677 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936588	3,732,526 - 3,737,219 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936588	3,733,103 - 3,734,770 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ALKBH7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	72,698,529 - 72,703,736 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	72,702,077 - 72,703,924 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	73,215,582 - 73,218,234 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ALKBH7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	5,988,610 - 5,991,194 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	5,988,371 - 5,991,136 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666081	2,032,188 - 2,034,764 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Alkbh7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624828	3,507,657 - 3,509,314 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624828	3,507,657 - 3,509,314 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Alkbh7
12 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	135
Count of miRNA genes:	106
Interacting mature miRNAs:	118
Transcripts:	ENSRNOT00000072118
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70226	Eae4	Experimental allergic encephalomyelitis QTL 4			nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	9	1	25661317	Rat
10054141	Gmadr4	Adrenal mass QTL 4	2.45	0.0074	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	9	1	14209783	Rat
9589158	Gluco65	Glucose level QTL 65	6.82	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	9	1	37999212	Rat
10054125	Srcrt7	Stress Responsive Cort QTL 7	3.33	0.0011	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	9	1	87073594	Rat
2303559	Gluco54	Glucose level QTL 54	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	1254084	46254084	Rat
7411592	Foco8	Food consumption QTL 8	7.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	1	37999212	Rat
1331757	Cdexp1	CD45RC expression in CD8 T cells QTL 1	4.3		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	9	1024537	67509080	Rat
1298088	Edpm11	Estrogen-dependent pituitary mass QTL 11	2.5		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	1	43718459	Rat
9589055	Scfw5	Subcutaneous fat weight QTL 5	5.55	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	9	1	37999212	Rat
1641911	Alcrsp13	Alcohol response QTL 13			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	1	43718459	Rat
1354650	Despr5	Despair related QTL 5	4.01	0.0017	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	9	1254084	46254084	Rat
1300124	Cm4	Cardiac mass QTL 4	3.55		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	9	1	40594091	Rat

Markers in Region

RH129643

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	1,840,583 - 1,840,772 (-)	MAPPER	mRatBN7.2
Rnor_6.0	9	10,045,646 - 10,045,834	NCBI	Rnor6.0
Rnor_5.0	9	9,046,296 - 9,046,484	UniSTS	Rnor5.0
Celera	9	6,676,516 - 6,676,704	UniSTS

RH130001

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	1,837,474 - 1,837,671 (-)	MAPPER	mRatBN7.2
Rnor_6.0	9	10,048,746 - 10,048,942	NCBI	Rnor6.0
Rnor_5.0	9	9,049,396 - 9,049,592	UniSTS	Rnor5.0
Celera	9	6,679,616 - 6,679,812	UniSTS
Cytogenetic Map	9	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109384	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039084196	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474092	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MW394906	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000072118 ⟹ ENSRNOP00000065514

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	1,838,910 - 1,841,044 (+)	Ensembl
Rnor_6.0 Ensembl	9	10,045,375 - 10,047,507 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097182 ⟹ ENSRNOP00000087380

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	1,838,811 - 1,841,044 (+)	Ensembl

RefSeq Acc Id:

NM_001109384 ⟹ NP_001102854

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	1,925,916 - 1,928,048 (+)	NCBI
mRatBN7.2	9	1,838,910 - 1,841,044 (+)	NCBI
Rnor_6.0	9	10,045,375 - 10,047,507 (-)	NCBI
Rnor_5.0	9	9,046,025 - 9,048,175 (-)	NCBI
Celera	9	6,676,245 - 6,678,377 (-)	RGD

Sequence:

show sequence

TCAGCCTTGTGCGGTCTGTCCTGAAGATGGCGGGCAGCTGGAGGCTAGCGATGCGCTTGCTTTC
TGGGTGCGGCTGGGTGCGCGGCTCGGACTCTGCGGTGCTGAGCCGCCTGCGTGATGAGGCCGTA
GTGCATCCAGGCTTCCTGAGCCAGGAGGAAGAGGACACGCTGACACGCGAACTGGAGCCCCAGC
TGCGGCGCCGGCGCTACGAGTACGACCACTGGGACTCGGCCATCCACGGCTTCAGGGAGACAGA
GAAATCCTGCTGGTCTGATGCAAGCCAGGCCATCCTGCAGCGGGTCCGTGCCGCTGCCTTTGGT
CCTGACCAGACCCTGCTATCTCTGGTCCATGTATTGGACCTGGAACATCGGGGCTACATCAAGC
CTCACGTTGACAGTGTCAAGTTCTGTGGATCTACCATCGCTGGCCTTTCCCTGTTGTCTCCAAG
TGTTATGAAACTGGTGCATACACAGGAACCTGAGCAGTGGCTGGAACTGTTGCTGGAACCTGGT
TCTCTCTATATCCTAAGGGGTTCAGCCCGATATGACTTCTCCCATGAGATCCTTAGAGATGAAG
AATCATTTTTTGGGGCACACCGGGTCCCCCGGGGCCGACGCATCTCAGTGATTTGCCGCTCCCT
CCCAGAGGGGATGGGGCCAGGAAGGCCAGAAGAGCCACCTCCAGCCTGCTAACCTCTCCACATA
TCCTCTAGACTTGTGAATAAAGTAGGAAAATGATTTCATGGGAATCTTCAAATTACCATCTGCC
AGGGCTGGGGCCCTTAAGAGATGATCAAGGTCTCAGGATTTACATAGCATGGTGGCTGCCAGGG
CGCACCCCATCACACACACTCTTAAGACCATAAGAATATCGTTTATTGCATTCACTACTGATAG
AAAACAAGCAAAAAAAAAAAAAAAAAAAAAAAAAACCAAACCCCAGGTCCCCTTTCTCTTCTTA
ATCTTCTCCTATGCAAGTTTCTAATAACGTC

hide sequence

RefSeq Acc Id:

XM_039084196 ⟹ XP_038940124

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	1,925,896 - 1,927,794 (+)	NCBI
mRatBN7.2	9	1,838,886 - 1,840,794 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001102854	(Get FASTA)	NCBI Sequence Viewer
	XP_038940124	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL83594	(Get FASTA)	NCBI Sequence Viewer
	EDL83595	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000065514.1
	ENSRNOP00000087380.1
GenBank Protein	QST76990	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001102854 ⟸ NM_001109384

- UniProtKB:

M0R7T2 (UniProtKB/TrEMBL), A6KQT7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAGSWRLAMRLLSGCGWVRGSDSAVLSRLRDEAVVHPGFLSQEEEDTLTRELEPQLRRRRYEYD
HWDSAIHGFRETEKSCWSDASQAILQRVRAAAFGPDQTLLSLVHVLDLEHRGYIKPHVDSVKFC
GSTIAGLSLLSPSVMKLVHTQEPEQWLELLLEPGSLYILRGSARYDFSHEILRDEESFFGAHRV
PRGRRISVICRSLPEGMGPGRPEEPPPAC

hide sequence

Ensembl Acc Id:

ENSRNOP00000065514 ⟸ ENSRNOT00000072118

RefSeq Acc Id:	XP_038940124 ⟸ XM_039084196
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A7M8 (UniProtKB/TrEMBL), A6KQT6 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000087380 ⟸ ENSRNOT00000097182

Protein Domains

Alpha-ketoglutarate-dependent dioxygenase AlkB-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-M0R7T2-F1-model_v2	AlphaFold	M0R7T2	1-221	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696444

Promoter ID:

EPDNEW_R6969

Type:

multiple initiation site

Name:

Alkbh7_1

Description:

alkB homolog 7

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	10,047,502 - 10,047,562	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1598126	AgrOrtholog
BioCyc Gene	G2FUF-28499	BioCyc
Ensembl Genes	ENSRNOG00000047089	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000072118.2	UniProtKB/TrEMBL
	ENSRNOT00000097182.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.120.590	UniProtKB/TrEMBL
InterPro	AlkB-like	UniProtKB/TrEMBL
	AlkB-like_sf	UniProtKB/TrEMBL
	ALKBH7	UniProtKB/TrEMBL
KEGG Report	rno:679944	UniProtKB/TrEMBL
NCBI Gene	679944	ENTREZGENE
PANTHER	ALPHA-KETOGLUTARATE-DEPENDENT DIOXYGENASE ALKB HOMOLOG 7, MITOCHONDRIAL	UniProtKB/TrEMBL
	PTHR21052	UniProtKB/TrEMBL
Pfam	2OG-FeII_Oxy_2	UniProtKB/TrEMBL
PhenoGen	Alkbh7	PhenoGen
RatGTEx	ENSRNOG00000047089	RatGTEx
Superfamily-SCOP	Clavaminate synthase-like	UniProtKB/TrEMBL
UniProt	A0A8A1U9H3_RAT	UniProtKB/TrEMBL
	A0A8I6A7M8	ENTREZGENE, UniProtKB/TrEMBL
	A6KQT6	ENTREZGENE, UniProtKB/TrEMBL
	A6KQT7	ENTREZGENE, UniProtKB/TrEMBL
	M0R7T2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-07-02	Alkbh7	alkB homolog 7	Alkbh7	alkB, alkylation repair homolog 7 (E. coli)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-07-08	Alkbh7	alkB, alkylation repair homolog 7 (E. coli)	LOC681562	similar to spermatogenesis associated 11	Data merged from RGD:1594076	1643240	APPROVED
2008-03-05	Alkbh7	alkB, alkylation repair homolog 7 (E. coli)	LOC679944	similar to spermatogenesis associated 11	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC679944	similar to spermatogenesis associated 11			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC681562	similar to spermatogenesis associated 11			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar