Advanced Search (OLGA)

Gene: Or5w18 (olfactory receptor family 5 subfamily W member 18) Rattus norvegicus

Analyze

No known orthologs.

Symbol:

Or5w18

Name:

olfactory receptor family 5 subfamily W member 18

RGD ID:

1333758

Description:

Predicted to enable odorant binding activity and olfactory receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway and detection of chemical stimulus involved in sensory perception of smell. Predicted to be located in plasma membrane. Orthologous to human OR5W2 (olfactory receptor family 5 subfamily W member 2).

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

olfactory receptor 590; olfactory receptor gene Olr590; olfactory receptor Olr590; Olr590

RGD Orthologs

Alliance Orthologs

More Info

homologs ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Alliance orthologs ³				less info ...
Homo sapiens (human):	OR5W2 (olfactory receptor family 5 subfamily W member 2)	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder)
Mus musculus (house mouse):	Or5w18 (olfactory receptor family 5 subfamily W member 18)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cdca4	Alliance	DIOPT (InParanoid\|OMA\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	or5f1l2.1	Alliance	DIOPT (Hieranoid\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	or5f1l1.3	Alliance	DIOPT (InParanoid\|OMA\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	or5f1l1.2	Alliance	DIOPT (InParanoid\|OMA\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	93,744,685 - 93,745,617 (+)	NCBI		GRCr8
mRatBN7.2	3	73,288,417 - 73,289,349 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	73,286,429 - 73,291,895 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	76,676,031 - 76,676,963 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	85,274,583 - 85,275,515 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	83,138,133 - 83,139,065 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	75,957,592 - 75,958,524 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	75,957,592 - 75,958,524 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	82,672,137 - 82,673,069 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	71,585,449 - 71,586,381 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	71,481,820 - 71,482,753 (+)	NCBI
Celera	3	72,580,404 - 72,581,336 (+)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

detection of chemical stimulus involved in sensory perception of smell (IEA)

G protein-coupled receptor signaling pathway (IEA)

Cellular Component

plasma membrane (IEA)

Molecular Function

G protein-coupled receptor activity (IEA)

odorant binding (IBA)

olfactory receptor activity (IBA,IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

taste/olfaction phenotype (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Variants

Variants in Or5w18
6 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	12
Count of miRNA genes:	12
Interacting mature miRNAs:	12
Transcripts:	ENSRNOT00000073455
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	43827364	90905114	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	53184692	89878207	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	39454637	89115240	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	78196190	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	28468571	73468571	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	28468571	73468571	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	15005422	76927699	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	89115240	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	53781112	91609953	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	38517803	83517803	Rat
631200	Cm25	Cardiac mass QTL 25	4.8	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	3	61134348	89115068	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	41874578	104104347	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001000658	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC111632	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000073455 ⟹ ENSRNOP00000067779

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	3	75,957,592 - 75,958,524 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000119379 ⟹ ENSRNOP00000085626

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	73,286,429 - 73,291,895 (+)	Ensembl

RefSeq Acc Id:

NM_001000658 ⟹ NP_001000658

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	93,744,685 - 93,745,617 (+)	NCBI
mRatBN7.2	3	73,288,417 - 73,289,349 (+)	NCBI
Rnor_6.0	3	75,957,592 - 75,958,524 (+)	NCBI
Rnor_5.0	3	82,672,137 - 82,673,069 (+)	NCBI
RGSC_v3.4	3	71,585,449 - 71,586,381 (+)	RGD
Celera	3	72,580,404 - 72,581,336 (+)	RGD

Sequence:

show sequence

ATGGAGAGAGAAAATTGTTCCTCCTTTACTGAATTCATATTAATGGGAATTACCAACAACACTG
AGGTAAAGGCAGCTCTATTCACAATATTTCTAGTGGTCTATCTGATCAACCTCATTGGGAATCT
TGGAATGATTGTTTTAATTAAAGTGGATCCACAGCTACAAACACCAATGTACTTTTTCCTCAGT
AACCTCTCCTTCTGTGATCTCTGCTATTCCTCTGCAGTTGGTCCTAAGATGTTAACAGACATAT
TTGGTAATGATAAGTCAATTCCTTTTTTTGGCTGTGCTTTGCAATTCTTCATTTCCTGTACATT
TGTGGACTCTGAGTGCATACTGCTGGCAGTGATGGCTTTTGACCGATACCAGGCCATCAGCAAT
CCCTTACTTTACACAACGAACATGTCCAGCAGACTGTGCTCCTTGCTAATGGCTGGAGTCTATC
TTGTAGGTGTGGCAGACTCTTTGATCCATACAACATTGACATTTCACTTGTGTTTCTGTGGATC
TAACGAAATTGATCACTTCTTTTGTGATATCCCTCCCATCTTACTACTGTCCTGCTCAGACACA
CAGGTCAATGAGTTAGCAATATTCACAATTTTTGGGTTTATTGAACTGAGCACCATCTCAGGAG
TTCTTGTCTCCTATTGTTACATCATCTCATCAGTCTTGAAGATCAGCTCTACTGAGGGTAGGTT
CAAAGCTTTCTCTACCTGTGCTTCTCACCTGATTGCAGTTGCGATTTTCCAAGGAACTGTGCTC
TTTATGTATTTCCGGCCAAGTTCTTCTTATTCTCTTGATCAAGACAAAATGAGCTCACTGTTTT
ATATCCTTGTGATACCGATGCTAAATCCTCTGATTTATAGCCTGAGGAACAAGGATGTGAAAGA
AGCTCTGAAAAAACTGAAAAATAAGAGATGCTGTTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001000658	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL79404	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000085626.1

RefSeq Acc Id:

NP_001000658 ⟸ NM_001000658

- UniProtKB:

A0A8I6A1U9 (UniProtKB/TrEMBL), A6HN03 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MERENCSSFTEFILMGITNNTEVKAALFTIFLVVYLINLIGNLGMIVLIKVDPQLQTPMYFFLS
NLSFCDLCYSSAVGPKMLTDIFGNDKSIPFFGCALQFFISCTFVDSECILLAVMAFDRYQAISN
PLLYTTNMSSRLCSLLMAGVYLVGVADSLIHTTLTFHLCFCGSNEIDHFFCDIPPILLLSCSDT
QVNELAIFTIFGFIELSTISGVLVSYCYIISSVLKISSTEGRFKAFSTCASHLIAVAIFQGTVL
FMYFRPSSSYSLDQDKMSSLFYILVIPMLNPLIYSLRNKDVKEALKKLKNKRCC

hide sequence

Ensembl Acc Id:

ENSRNOP00000067779 ⟸ ENSRNOT00000073455

Ensembl Acc Id:

ENSRNOP00000085626 ⟸ ENSRNOT00000119379

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-M0RDS1-F1-model_v2	AlphaFold	M0RDS1	1-310	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1333758	AgrOrtholog
BioCyc Gene	G2FUF-48948	BioCyc
Ensembl Genes	ENSRNOG00000049292	Ensembl
	ENSRNOG00000069424	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000119379.1	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
NCBI Gene	404858	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
	OLFACTORY RECEPTOR-RELATED	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or5w18	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000049292	RatGTEx
	ENSRNOG00000069424	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A0A8I6A1U9	ENTREZGENE, UniProtKB/TrEMBL
	A6HN03	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or5w18	olfactory receptor family 5 subfamily W member 18	Olr590	olfactory receptor 590	Symbol and Name Changed	1299863	APPROVED
2008-04-30	Olr590	olfactory receptor 590	Olr590_predicted	olfactory receptor 590 (predicted)	'predicted' is removed	2292626	APPROVED
2005-02-04	Olr590_predicted	olfactory receptor 590 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Mammalian Phenotype