Advanced Search (OLGA)

Gene: Or8b3c (olfactory receptor family 8 subfamily B member 3C) Rattus norvegicus

Analyze

No known orthologs.

Symbol:

Or8b3c

Name:

olfactory receptor family 8 subfamily B member 3C

RGD ID:

1333520

Description:

Predicted to enable odorant binding activity and olfactory receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway and sensory perception of smell. Predicted to be located in plasma membrane. Orthologous to human OR8B3 (olfactory receptor family 8 subfamily B member 3); INTERACTS WITH furan.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

olfactory receptor 1231; olfactory receptor gene Olr1231; olfactory receptor Olr1231; Olr1231

RGD Orthologs

Alliance Orthologs

More Info

homologs ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Other homologs ²				less info ...
Homo sapiens (human):	OR8B2 (olfactory receptor family 8 subfamily B member 2)	HGNC	Ensembl, HomoloGene
Homo sapiens (human):	OR8B3 (olfactory receptor family 8 subfamily B member 3)	HGNC	Ensembl, HomoloGene
Alliance orthologs ³
Homo sapiens (human):	OR8B2 (olfactory receptor family 8 subfamily B member 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	OR8B3 (olfactory receptor family 8 subfamily B member 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Or8b3 (olfactory receptor family 8 subfamily B member 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Or8b3 (olfactory receptor family 8 subfamily B member 3)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	or5dd2b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	or5dd3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	or5ds1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder)
Xenopus tropicalis (tropical clawed frog):	LOC100485431	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder)
Xenopus tropicalis (tropical clawed frog):	or5dd2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	47,379,226 - 47,380,176 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	47,379,226 - 47,380,176 (+)	Ensembl				GRCr8
mRatBN7.2	8	38,482,017 - 38,482,967 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	38,482,017 - 38,482,967 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	43,964,966 - 43,965,916 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	42,249,023 - 42,249,973 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	40,111,070 - 40,112,020 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	1,430,948 - 1,431,898 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	1,430,948 - 1,431,898 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	1,422,263 - 1,423,213 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	40,507,303 - 40,508,253	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
RGSC_v3.1	8	40,516,068 - 40,517,019	NCBI
Cytogenetic Map	8	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

furan (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

detection of chemical stimulus involved in sensory perception of smell (IEA)

G protein-coupled receptor signaling pathway (IBA,IEA)

sensory perception of smell (IBA,IEA)

signal transduction (IEA)

Cellular Component

membrane (IEA)

plasma membrane (IEA)

Molecular Function

G protein-coupled receptor activity (IEA)

odorant binding (IBA)

olfactory receptor activity (IBA,IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

taste/olfaction phenotype (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Variants

Variants in Or8b3c
3 total Variants

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39752803	84752803	Rat
1357398	Slep3	Serum leptin concentration QTL 3	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	17994105	50763951	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	39106258	91341052	Rat
2317030	Wbc5	White blood cell count QTL 5	3.21	0.005	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	8	16994642	61994642	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	39106258	91341052	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	39106363	103375781	Rat
2301416	Bp315	Blood pressure QTL 315		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	15952279	60952279	Rat
2317032	Ginf2	Gastrointestinal inflammation QTL 2	3.21	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	8	12964165	57964165	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	39106258	84106258	Rat
2317036	Livw3	Liver weight QTL 3	2.43	0.01	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	8	12964165	57964165	Rat
12880023	Bw184	Body weight QTL 184		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	10382540	55382540	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	39106363	103375781	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	44477926	89477926	Rat
2317051	Aia18	Adjuvant induced arthritis QTL 18	2.42		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	8	16994642	61994642	Rat
12880028	Cm103	Cardiac mass QTL 103		0.02	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	10382540	55382540	Rat
61337	Bp22	Blood pressure QTL 22	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	51589833	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	39106258	103375958	Rat
2317048	Ginf1	Gastrointestinal inflammation QTL 1	3.52	0.005	cecum mucosa thickness (VT:0010234)	enterocolitis severity score (CMO:0002138)	8	12964165	57964165	Rat
12880025	Cm102	Cardiac mass QTL 102		0.044	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	8	10382540	55382540	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	39106258	91341052	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	35464071	107982864	Rat
2302278	Gluco36	Glucose level QTL 36	4.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	37760859	58991895	Rat
12880044	Am9	Aortic mass QTL 9		0.007	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	10382540	55382540	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	37760859	61459705	Rat
631648	Stl5	Serum triglyceride level QTL 5	4	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	35464071	71842899	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	39106258	84106258	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	31543661	76543661	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	84106258	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	44447837	89447837	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	35464071	107982864	Rat
1598824	Memor4	Memory QTL 4	2.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	8	17993862	62252873	Rat
1331744	Bp217	Blood pressure QTL 217	3.398		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	67378345	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39106363	114525825	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	39106258	91341052	Rat
724540	Uae8	Urinary albumin excretion QTL 8	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	8	39106258	103375958	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	35464071	107982864	Rat
1359021	Bp271	Blood pressure QTL 271	1.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	34125902	55607752	Rat
2302367	Slep5	Serum leptin concentration QTL 5	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	17994105	50763951	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	44475043	89475043	Rat
70206	Alc20	Alcohol consumption QTL 20	2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	8	39106258	49610361	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

endocrine system	endoderm	exocrine system	hepatobiliary system	mesenchyme	renal system	reproductive system
1	1	1	1	2	1	9

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001000813	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC097089	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000088867 ⟹ ENSRNOP00000073475

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	47,379,226 - 47,380,176 (+)	Ensembl
mRatBN7.2 Ensembl	8	38,482,017 - 38,482,967 (+)	Ensembl
Rnor_6.0 Ensembl	4	1,430,948 - 1,431,898 (+)	Ensembl

RefSeq Acc Id:

NM_001000813 ⟹ NP_001000813

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	47,379,226 - 47,380,176 (+)	NCBI
mRatBN7.2	8	38,482,017 - 38,482,967 (+)	NCBI
Rnor_6.0	4	1,430,948 - 1,431,898 (+)	NCBI
Rnor_5.0	4	1,422,263 - 1,423,213 (+)	NCBI
RGSC_v3.4	8	40,507,303 - 40,508,253 (+)	RGD

Sequence:

show sequence

ATGGTAAGCATGCGGGCAGGAAATGGCTCCTTTGTGACTGAATTTATTCTTGCTGGTTTGACAG
ACCTTCCAGAGCTCCAGCTGCCTCTCTTTTACCTGTTTCTAATAATCTACATAATCACAGTGGT
GGGAAACATTGGCTTGATCACCTTGATTAGCCTCAATCCTCACCTGCACACCCCGATGTACTAT
TTCCTCTTCAACCTCTCCTTCATTGATCTCAGCTACTCTTCTGTCTTCAGCCCCAAAATGCTGA
TGAACTTTGTCTCTGAGAAGAATTCCATCTCCTATGAGGGGTGCATGACTCAGCTGTTTTTCTT
TCTCTTTTTTGTCATCTCTGAATGCTATATGTTGACCTCAATGGCCTATGATCGCTATGTGGCC
ATTTGTAATCCACTGCTATATAAGGTCTCAATGTCCCCTCAGGTCTGTTCTATTCTATCTTTTG
CTGCTTATGGGATGGGGTTTGCTGGAGCCTCTGTCCATACAGGCTGCATGCTCAGACTGACTTT
CTGTAATGCCAATCTCATCAACCATTACTTGTGTGACATTCTCCCTCTCCTCCAACTTTCTTGT
ACCAGCACTTATGTCAACGAGGTGGTTGTTCTTGTAGTTGTGGGTATTAACATCACAGTCCCCA
GCTGTACAATCCTCATCTCCTATGTTTTCATCCTTGCCAATATTCTAAACATCAAATCCACACA
AGGAAGGTCAAAAGCCTTCAGTAACTGTAGCTCTCACATCATGGCTATTTCTCTTTTCTTTGGA
TCAGCTGCATTCATGTATCTTAAATATTCTTCTGGATCTATGGAACATGGAAAAATATCTTCAG
TTTTCTACACTAATGTTGGGCCCATGCTCAACCCTCTGATCTACAGTTTGAGGAACAAAGATGT
CAAGGTGGCGTTAAGGAAATCATTGATTAAGTTTCAGAGAAAAGACAAATTCTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001000813	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000073475
	ENSRNOP00000073475.1

RefSeq Acc Id:

NP_001000813 ⟸ NM_001000813

- UniProtKB:

A0A0G2K5L8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVSMRAGNGSFVTEFILAGLTDLPELQLPLFYLFLIIYIITVVGNIGLITLISLNPHLHTPMYY
FLFNLSFIDLSYSSVFSPKMLMNFVSEKNSISYEGCMTQLFFFLFFVISECYMLTSMAYDRYVA
ICNPLLYKVSMSPQVCSILSFAAYGMGFAGASVHTGCMLRLTFCNANLINHYLCDILPLLQLSC
TSTYVNEVVVLVVVGINITVPSCTILISYVFILANILNIKSTQGRSKAFSNCSSHIMAISLFFG
SAAFMYLKYSSGSMEHGKISSVFYTNVGPMLNPLIYSLRNKDVKVALRKSLIKFQRKDKF

hide sequence

Ensembl Acc Id:

ENSRNOP00000073475 ⟸ ENSRNOT00000088867

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2K5L8-F1-model_v2	AlphaFold	A0A0G2K5L8	1-316	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1333520	AgrOrtholog
BioCyc Gene	G2FUF-30967	BioCyc
Ensembl Genes	ENSRNOG00000058298	Ensembl
	ENSRNOG00000068253	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000088867	ENTREZGENE
	ENSRNOT00000088867.3	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
KEGG Report	rno:405099	UniProtKB/TrEMBL
NCBI Gene	405099	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or8b3c	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000058298	RatGTEx
	ENSRNOG00000068253	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A0A0G2K5L8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or8b3c	olfactory receptor family 8 subfamily B member 3C	Olr1231	olfactory receptor 1231	Symbol and Name Changed	1299863	APPROVED
2008-04-30	Olr1231	olfactory receptor 1231	Olr1231_predicted	olfactory receptor 1231 (predicted)	'predicted' is removed	2292626	APPROVED
2005-02-04	Olr1231_predicted	olfactory receptor 1231 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Mammalian Phenotype