Advanced Search (OLGA)

Gene: Cib2 (calcium and integrin binding family member 2) Rattus norvegicus

Analyze

Symbol:

Cib2

Name:

calcium and integrin binding family member 2

RGD ID:

1308718

Description:

Predicted to enable integrin binding activity; metal ion binding activity; and protein homodimerization activity. Predicted to be involved in several processes, including calcium ion homeostasis; cellular response to ATP; and photoreceptor cell maintenance. Predicted to be located in several cellular components, including cuticular plate; muscle tendon junction; and sarcolemma. Predicted to be active in cell periphery; cytoplasm; and stereocilium. Human ortholog(s) of this gene implicated in Usher syndrome type 1J and autosomal recessive nonsyndromic deafness 48. Orthologous to human CIB2 (calcium and integrin binding family member 2); INTERACTS WITH 2,2',5,5'-tetrachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

calcium and integrin-binding family member 2; LOC300719; MGC109329

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	63,826,410 - 63,843,301 (-)	NCBI		GRCr8
mRatBN7.2	8	54,930,265 - 54,947,157 (-)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	8	60,464,045 - 60,480,583 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	58,743,039 - 58,759,577 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	56,607,273 - 56,623,811 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	59,123,078 - 59,139,946 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	59,123,079 - 59,139,946 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	57,703,517 - 57,720,644 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	58,093,941 - 58,110,808 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	58,112,995 - 58,129,862 (-)	NCBI
Celera	8	54,418,915 - 54,435,782 (-)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal recessive nonsyndromic deafness (ISO)

autosomal recessive nonsyndromic deafness 48 (ISO,ISS)

Bloom syndrome (ISO)

colorectal cancer (ISO)

genetic disease (ISO)

Hearing Loss (ISO)

Usher syndrome (ISO)

Usher syndrome type 1 (ISO)

Usher syndrome type 1J (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

2,2',5,5'-tetrachlorobiphenyl (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,4,5,3',4',5'-Hexachlorobiphenyl (EXP)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

acrylamide (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

cadmium dichloride (EXP)

carbamazepine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

cisplatin (EXP)

dexamethasone (EXP)

Dibutyl phosphate (ISO)

diuron (EXP)

epoxiconazole (ISO)

furan (EXP)

linezolid (EXP)

methapyrilene (ISO)

methimazole (EXP)

N-nitrosodiethylamine (ISO)

paracetamol (ISO)

PCB138 (EXP)

pentanal (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

potassium chromate (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

testosterone (EXP)

tetrachloroethene (ISO)

tetrachloromethane (ISO)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

calcium ion homeostasis (IBA,ISO,ISS)

cellular response to ATP (ISO,ISS)

photoreceptor cell maintenance (ISO,ISS)

positive regulation of cytosolic calcium ion concentration (ISO,ISS)

Cellular Component

cell periphery (IBA)

cuticular plate (ISO,ISS)

cytoplasm (IBA,ISO,ISS)

cytosol (TAS)

muscle tendon junction (ISO)

neuromuscular junction (ISO)

photoreceptor inner segment (ISO,ISS)

photoreceptor outer segment (ISO,ISS)

sarcolemma (ISO)

stereocilium (IBA,ISO,ISS)

Molecular Function

calcium ion binding (IBA,ISO,ISS)

integrin binding (ISO)

magnesium ion binding (IBA,ISO,ISS)

protein binding (ISO)

protein homodimerization activity (ISO,ISS)

protein-containing complex binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:18611855	PMID:19433056	PMID:22516433	PMID:22779914	PMID:23023331	PMID:26173970	PMID:26426422

Genomics

Comparative Map Data

Cib2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	63,826,410 - 63,843,301 (-)	NCBI		GRCr8
mRatBN7.2	8	54,930,265 - 54,947,157 (-)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	8	60,464,045 - 60,480,583 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	58,743,039 - 58,759,577 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	56,607,273 - 56,623,811 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	59,123,078 - 59,139,946 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	59,123,079 - 59,139,946 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	57,703,517 - 57,720,644 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	58,093,941 - 58,110,808 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	58,112,995 - 58,129,862 (-)	NCBI
Celera	8	54,418,915 - 54,435,782 (-)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

CIB2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	78,104,606 - 78,131,535 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	78,104,606 - 78,131,535 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	78,396,948 - 78,423,877 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	76,184,046 - 76,210,933 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	76,184,045 - 76,210,933	NCBI
Celera	15	55,333,003 - 55,359,888 (-)	NCBI		Celera
Cytogenetic Map	15	q25.1	NCBI
HuRef	15	55,154,506 - 55,181,422 (-)	NCBI		HuRef
CHM1_1	15	78,514,886 - 78,541,781 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	75,967,162 - 75,994,101 (-)	NCBI		T2T-CHM13v2.0

Cib2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	54,452,074 - 54,467,512 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	54,452,078 - 54,467,502 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	54,544,794 - 54,560,190 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	54,544,794 - 54,560,218 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	54,393,159 - 54,407,886 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	54,342,933 - 54,358,324 (-)	NCBI		MGSCv36	mm8
Celera	9	51,788,257 - 51,803,325 (-)	NCBI		Celera
Cytogenetic Map	9	A5.3	NCBI
cM Map	9	29.7	NCBI

Cib2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955450	659,383 - 675,634 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955450	660,655 - 674,726 (-)	NCBI	ChiLan1.0	ChiLan1.0

CIB2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	67,318,400 - 67,345,020 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	71,483,918 - 71,510,707 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	57,033,782 - 57,060,650 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	75,998,797 - 76,025,485 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	75,998,797 - 76,025,485 (-)	Ensembl	panpan1.1		panPan2

CIB2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	3	60,968,808 - 60,983,455 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	58,745,271 - 58,759,919 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	58,743,365 - 58,760,158 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	58,241,794 - 58,256,438 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	58,449,915 - 58,464,422 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	58,798,942 - 58,813,472 (-)	NCBI		UU_Cfam_GSD_1.0

Cib2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	119,010,960 - 119,031,107 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	36,859,018 - 36,878,878 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	36,859,018 - 36,879,170 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CIB2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	47,788,646 - 47,813,399 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	47,807,806 - 47,813,400 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	53,330,804 - 53,365,124 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CIB2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	5,222,657 - 5,248,133 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	5,222,902 - 5,248,191 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	136,554,738 - 136,580,711 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cib2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624894	2,688,814 - 2,704,747 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624894	2,688,784 - 2,704,742 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cib2
95 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	158
Count of miRNA genes:	124
Interacting mature miRNAs:	136
Transcripts:	ENSRNOT00000013622
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30856404	75856404	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	41866876	86866876	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	30848154	61290444	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1582222	Epfw2	Epididymal fat weight QTL 2	3.2	0.0005	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	8	31737729	76737729	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	35582032	80582032	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	50095249	82460899	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1300146	Rf17	Renal function QTL 17	2.9		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	8	28242912	73242912	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
1300150	Cm3	Cardiac mass QTL 3	3.97		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	54237814	55523877	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	29502665	70386295	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	30848154	61290444	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	22662330	67662330	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	40713066	82925667	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	61290444	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	41866876	75097878	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	35551938	80551938	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
1331744	Bp217	Blood pressure QTL 217	3.398		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	58482492	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	54237644	85365202	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
631216	Stl9	Serum triglyceride level QTL 9	4.71	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	8	41867010	70386132	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	50095249	82460899	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	54237644	85365202	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	16290444	61290444	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	54259986	100382532	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	50095249	82460899	Rat
1558646	Swd5	Spike wave discharge measurement QTL 5	3.45	0.00036	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	8	14906751	59906751	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	54043744	98968765	Rat
631648	Stl5	Serum triglyceride level QTL 5	4	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	27205715	54998217	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
2303564	Gluco43	Glucose level QTL 43	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	26130187	71130187	Rat
2303570	Gluco48	Glucose level QTL 48	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	49805831	94805831	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
2303572	Insul13	Insulin level QTL 13	2		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	8	26130187	71130187	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	54237644	99103503	Rat

Markers in Region

RH133562

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	54,930,297 - 54,930,513 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	59,123,111 - 59,123,326	NCBI	Rnor6.0
Rnor_5.0	8	57,703,550 - 57,703,765	UniSTS	Rnor5.0
RGSC_v3.4	8	58,093,974 - 58,094,189	UniSTS	RGSC3.4
Celera	8	54,418,948 - 54,419,163	UniSTS
Cytogenetic Map	8	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001015010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006243071	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC112328	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC092630	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000078571 ⟹ ENSRNOP00000071683

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	8	59,123,079 - 59,139,946 (-)	Ensembl

RefSeq Acc Id:

NM_001015010 ⟹ NP_001015010

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	63,826,410 - 63,843,277 (-)	NCBI
mRatBN7.2	8	54,930,265 - 54,947,135 (-)	NCBI
Rnor_6.0	8	59,123,078 - 59,139,946 (-)	NCBI
Rnor_5.0	8	57,703,517 - 57,720,644 (-)	NCBI
RGSC_v3.4	8	58,093,941 - 58,110,808 (-)	RGD
Celera	8	54,418,915 - 54,435,782 (-)	RGD

Sequence:

show sequence

CCCTCCCACTGAACTGCAGGACCAAGCGGAGCGGGCAAGCCTAGGCTGGCGACGCTGCCCGCTC
CCGGGCTTGCAAGGGCCGCGGGCGCGGGGCTCGGGGCTCCAGAAGCCGCCGATGGGAAGCAGCA
ATCGAAAGGGCGAGAGACGCCGCCGCGGCCATCCATACCACCGCGGTTACCATGGGGAATAAGC
AGACCATCTTCACAGAAGAGCAGCTGGACAACTACCAGGACTGCACTTTCTTCAATAAGAAGGA
CATCCTCAAGCTTCATGCACGGTTCTATGAGCTGGCTCCCAACCTCGTCCCGATGGACTACAGG
AAGAGCCCCATCGTCCACGTGCCCATGAGCCTCATCATTCAGATGCCGGAGCTCCGGGAGAATC
CTTTCAAGGAGAGGATTGTGGAGGCTTTCTCTGAGGACGGTGAGGGGAACCTCACCTTCAATGA
CTTTGTGGACATGTTCTCTGTGCTCTGTGAGTCGGCGCCTCGGGAGCTCAAGGCGAACTATGCC
TTCAAGATCTATGACTTCAACACTGACAATTTCATCTGTAAAGAAGACTTAGAGCTGACACTGG
CCAGACTTACTAAGTCAGAGCTGGATGAAGATGAGGTAGTGCTTGTGTGTGACAAAGTCATTGA
AGAAGCTGACCTGGACGGTGATGGCAAGCTAGGCTTTGCCGACTTTGAGGACATGATCGCCAAG
GCCCCTGACTTTCTCAGCACTTTCCACATCCGAATCTGAGGACACTGCCAAGGCTGTGGGGCCC
CGGACTCCGTCCTCTGGCCTGCTGTCTACGCAGGTATGGTTTTCAAGTGCTCCAGGGAAGGAGC
TGTGGCCTTTGGGGTTCTCACCCGTGGACATTTCCTGTGGCCCTTTCAGCAAAAAATAATCAAT
TAATAAATTAAAAATAAAAATGAATAGAAAACCTAACTGCAATGGGGTTGTGAAGAGCAGGACC
CTTCTCCAGGCCTCCAGTGTCTACCCTCAAGACCTGCATTTCCCCTGCAGGCCCTCTCACCCAC
CCCCTTGCCCAGTTCTTTTCTCACCTGGGAGGGGAAGGTAGAAAAACCTTGCAGGAGAGGTAAG
GCTGAATTATCTGTGTGCTGGGCAGGCACTCCAGTCACCCAGGGGTAAGTGCAAAAACCAAACA
AACAAAGAAACAAAGGAAACAGAGCCTGGGGTTCTATGCAATCTTTTACCAAAGCCAAGGCTGG
GCTGTACCCACCTCCAACCCCATGCTTTCCCAATGTGAAGTTGTATACGAAGTTAGGTCCAAAG
GGCTCTGCCCCCATGTCACGAACACTACTCCACCCCACCCCACCCCATCCCCGATGACGTGGTA
TCACTGATGTGTGCTGACCTCAGATTTGTGAATTCCTAGAAATAAAGCACTTTTGTGTCCTGCA
AAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006243071 ⟹ XP_006243133

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	63,826,410 - 63,843,301 (-)	NCBI
mRatBN7.2	8	54,930,265 - 54,947,157 (-)	NCBI
Rnor_6.0	8	59,123,078 - 59,139,928 (-)	NCBI
Rnor_5.0	8	57,703,517 - 57,720,644 (-)	NCBI

Sequence:

show sequence

GGACCAAGCGGAGCGGGCAAGCCTAGGCTGGCGACGCTGCCCGCTCCCGGGCTTGCAAGGGCCG
CGGGCGCGGGGCTCGGGGCTCCAGAAGCCGCCGATGGGAAGCAGCAATCGAAAGGGCGAGAGAC
GCCGCCGCGGCCATCCATACCACCGCGGTTACCATGGGGAATAAGCAGACCATCTTCACAGAAG
AGCAGCTGGACAACTACCAGGCTTCATGCACGGTTCTATGAGCTGGCTCCCAACCTCGTCCCGA
TGGACTACAGGAAGAGCCCCATCGTCCACGTGCCCATGAGCCTCATCATTCAGATGCCGGAGCT
CCGGGAGAATCCTTTCAAGGAGAGGATTGTGGAGGCTTTCTCTGAGGACGGTGAGGGGAACCTC
ACCTTCAATGACTTTGTGGACATGTTCTCTGTGCTCTGTGAGTCGGCGCCTCGGGAGCTCAAGG
CGAACTATGCCTTCAAGATCTATGACTTCAACACTGACAATTTCATCTGTAAAGAAGACTTAGA
GCTGACACTGGCCAGACTTACTAAGTCAGAGCTGGATGAAGATGAGGTAGTGCTTGTGTGTGAC
AAAGTCATTGAAGAAGCTGACCTGGACGGTGATGGCAAGCTAGGCTTTGCCGACTTTGAGGACA
TGATCGCCAAGGCCCCTGACTTTCTCAGCACTTTCCACATCCGAATCTGAGGACACTGCCAAGG
CTGTGGGGCCCCGGACTCCGTCCTCTGGCCTGCTGTCTACGCAGGTATGGTTTTCAAGTGCTCC
AGGGAAGGAGCTGTGGCCTTTGGGGTTCTCACCCGTGGACATTTCCTGTGGCCCTTTCAGCAAA
AAATAATCAATTAATAAATTAAAAATAAAAAATGAATAGAAAACCTAACTGCAATGGGGTTGTG
AAGAGCAGGACCCTTCTCCAGGCCTCCAGTGTCTACCCTCAAGACCTGCATTTCCCCTGCAGGC
CCTCTCACCCACCCCCTTGCCCAGTTCTTTTCTCACCTGGGAGGGGAAGGTAGAAAAACCTTGC
AGGAGAGGTAAGGCTGAATTATCTGTGTGCTGGGCAGGCACTCCAGTCACCCAGGGGTAAGTGC
AAAAACCAAACAAACAAAGAAACAAAGGAAACAGAGCCTGGGGTTCTATGCAATCTTTTACCAA
AGCCAAGGCTGGGCTGTACCCACCTCCAACCCCATGCTTTCCCAATGTGAAGTTGTATACGAAG
TTAGGTCCAAAGGGCTCTGCCCCCATGTCACGAACACTACTCCACCCCACCCCACCCCATCCCC
GATGACGTGGTATCACTGATGTGTGCTGACCTCAGATTTGTGAATTCCTAGAAATAAAGCACTT
TTGTGTCCTGCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001015010	(Get FASTA)	NCBI Sequence Viewer
	XP_006243133	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH92630	(Get FASTA)	NCBI Sequence Viewer
	EDL95538	(Get FASTA)	NCBI Sequence Viewer
	EDL95539	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00055044046
	ENSRNOP00060024720
	ENSRNOP00065022845
GenBank Protein	Q568Z7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001015010 ⟸ NM_001015010
- UniProtKB:	Q568Z7 (UniProtKB/Swiss-Prot), A6J4L5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHARFYELAPNLVPMDYRKSPIVHVPMSLIIQMPE LRENPFKERIVEAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDL ELTLARLTKSELDEDEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI hide sequence

RefSeq Acc Id:	XP_006243133 ⟸ XM_006243071
- Peptide Label:	isoform X1
- UniProtKB:	A6J4L6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MDYRKSPIVHVPMSLIIQMPELRENPFKERIVEAFSEDGEGNLTFNDFVDMFSVLCESAPRELK ANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEDEVVLVCDKVIEEADLDGDGKLGFADFED MIAKAPDFLSTFHIRI hide sequence

Ensembl Acc Id:

ENSRNOP00000071683 ⟸ ENSRNOT00000078571

Protein Domains

EF-hand

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q568Z7-F1-model_v2	AlphaFold	Q568Z7	1-187	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695980

Promoter ID:

EPDNEW_R6504

Type:

multiple initiation site

Name:

Cib2_1

Description:

calcium and integrin binding family member 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	59,139,942 - 59,140,002	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308718	AgrOrtholog
BioCyc Gene	G2FUF-30396	BioCyc
Ensembl Genes	ENSRNOG00000059834	Ensembl
	ENSRNOG00055030706	UniProtKB/Swiss-Prot
	ENSRNOG00060017853	UniProtKB/Swiss-Prot
	ENSRNOG00065017330	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00055053282	UniProtKB/Swiss-Prot
	ENSRNOT00060030568	UniProtKB/Swiss-Prot
	ENSRNOT00065028876	UniProtKB/Swiss-Prot
Gene3D-CATH	EF-hand	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7314828	IMAGE-MGC_LOAD
InterPro	CIBP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EF-hand-dom_pair	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EF_Hand_1_Ca_BS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EF_hand_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:300719	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:109329	IMAGE-MGC_LOAD
NCBI Gene	300719	ENTREZGENE
PANTHER	CALCIUM AND INTEGRIN BINDING FAMILY MEMBER 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CALCIUM AND INTEGRIN-BINDING FAMILY MEMBER 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	EF-hand_7	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Cib2	PhenoGen
PROSITE	EF_HAND_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EF_HAND_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000059834	RatGTEx
	ENSRNOG00055030706	RatGTEx
	ENSRNOG00060017853	RatGTEx
	ENSRNOG00065017330	RatGTEx
SMART	EFh	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	EF-hand	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6J4L5	ENTREZGENE, UniProtKB/TrEMBL
	A6J4L6	ENTREZGENE, UniProtKB/TrEMBL
	CIB2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Cib2	calcium and integrin binding family member 2	Cib2_predicted	calcium and integrin binding family member 2 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Cib2_predicted	calcium and integrin binding family member 2 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM