Symbol:
Matk
Name:
megakaryocyte-associated tyrosine kinase
RGD ID:
69058
Description:
Predicted to enable non-membrane spanning protein tyrosine kinase activity. Predicted to be located in cytoplasm. Predicted to be active in plasma membrane. Orthologous to human MATK (megakaryocyte-associated tyrosine kinase); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Batk; megakaryocyte-associated tyrosine kinase (non-receptor protein tyrosine kinase); megakaryocyte-associated tyrosine-protein kinase; MGC105436; non-receptor protein kinase protein; protein kinase BATK; tyrosine-protein kinase CTK
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 9,107,711 - 9,116,864 (-) NCBI GRCr8 mRatBN7.2 7 8,456,990 - 8,465,947 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 8,456,998 - 8,462,022 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 11,341,194 - 11,346,217 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 13,216,677 - 13,221,700 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 11,084,145 - 11,089,168 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 11,325,246 - 11,334,311 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 11,325,254 - 11,330,278 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 11,492,654 - 11,498,451 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 9,940,799 - 9,945,824 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 9,940,799 - 9,945,824 (-) NCBI Celera 7 6,645,321 - 6,650,346 (-) NCBI Celera Cytogenetic Map 7 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Matk Rat (2,4,5-trichlorophenoxy)acetic acid increases expression ISO Matk (Mus musculus) 6480464 2 more ... CTD PMID:18579281 Matk Rat 1,2-dimethylhydrazine increases expression ISO Matk (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of MATK mRNA CTD PMID:22206623 Matk Rat 17alpha-ethynylestradiol multiple interactions ISO Matk (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MATK mRNA CTD PMID:17942748 Matk Rat 17alpha-ethynylestradiol increases expression ISO Matk (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of MATK mRNA CTD PMID:17942748 Matk Rat 17beta-estradiol increases expression ISO MATK (Homo sapiens) 6480464 Estradiol results in increased expression of MATK mRNA CTD PMID:23019147 and PMID:31614463 Matk Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Matk (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MATK mRNA CTD PMID:17942748 Matk Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MATK mRNA CTD PMID:34747641 Matk Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of MATK mRNA CTD PMID:22298810 Matk Rat 2-aminopurine multiple interactions ISO Matk (Mus musculus) 6480464 2-Aminopurine inhibits the reaction [[TNF protein co-treated with TNFSF11 protein] results in increased expression of MATK protein] CTD PMID:25739386 Matk Rat 4,4'-diaminodiphenylmethane decreases expression ISO Matk (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of MATK mRNA CTD PMID:18648102 Matk Rat 4,4'-sulfonyldiphenol increases methylation ISO Matk (Mus musculus) 6480464 bisphenol S results in increased methylation of MATK promoter CTD PMID:33297965 Matk Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of MATK mRNA CTD PMID:36041667 Matk Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of MATK mRNA CTD PMID:24780913 Matk Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of MATK mRNA CTD PMID:31881176 Matk Rat aflatoxin B1 decreases methylation ISO MATK (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of MATK promoter CTD PMID:30157460 Matk Rat all-trans-retinoic acid decreases expression ISO MATK (Homo sapiens) 6480464 Tretinoin results in decreased expression of MATK mRNA CTD PMID:33167477 Matk Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MATK mRNA CTD PMID:16483693 Matk Rat aristolochic acid A increases expression ISO MATK (Homo sapiens) 6480464 aristolochic acid I results in increased expression of MATK mRNA CTD PMID:33212167 Matk Rat arsane affects expression ISO MATK (Homo sapiens) 6480464 Arsenic affects the expression of MATK mRNA CTD PMID:18414638 Matk Rat arsenic atom affects expression ISO MATK (Homo sapiens) 6480464 Arsenic affects the expression of MATK mRNA CTD PMID:18414638 Matk Rat arsenous acid decreases expression ISO MATK (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of MATK mRNA CTD PMID:19128835 Matk Rat benzo[a]pyrene increases expression ISO Matk (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of MATK mRNA CTD PMID:22228805 Matk Rat benzo[a]pyrene affects methylation ISO MATK (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of MATK 5' UTR and Benzo(a)pyrene affects the methylation of MATK promoter CTD PMID:27901495 Matk Rat bis(2-chloroethyl) sulfide increases expression ISO Matk (Mus musculus) 6480464 Mustard Gas results in increased expression of MATK mRNA CTD PMID:15674844 Matk Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MATK mRNA CTD PMID:25181051 Matk Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of MATK mRNA CTD PMID:36041667 Matk Rat bisphenol F decreases expression ISO Matk (Mus musculus) 6480464 bisphenol F results in decreased expression of MATK mRNA CTD PMID:38685157 Matk Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of MATK mRNA CTD PMID:36041667 Matk Rat cadmium dichloride multiple interactions ISO MATK (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of MATK mRNA CTD PMID:12634122 Matk Rat calcium silicate increases expression ISO Matk (Mus musculus) 6480464 calcium silicate results in increased expression of MATK mRNA CTD PMID:29279043 Matk Rat carbon nanotube increases expression ISO Matk (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Matk Rat chlorpyrifos increases expression ISO Matk (Mus musculus) 6480464 Chlorpyrifos results in increased expression of MATK mRNA CTD PMID:32715474 Matk Rat choline multiple interactions ISO Matk (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of MATK mRNA CTD PMID:20938992 Matk Rat cisplatin multiple interactions ISO MATK (Homo sapiens) 6480464 [Cisplatin co-treated with Paclitaxel] results in decreased expression of MATK mRNA CTD PMID:20705681 Matk Rat copper(II) sulfate increases expression ISO Matk (Mus musculus) 6480464 Copper Sulfate results in increased expression of MATK mRNA CTD PMID:18579281 Matk Rat diarsenic trioxide decreases expression ISO MATK (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of MATK mRNA CTD PMID:19128835 Matk Rat Dibutyl phosphate affects expression ISO MATK (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MATK mRNA CTD PMID:37042841 Matk Rat dichromium trioxide multiple interactions ISO MATK (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of MATK mRNA CTD PMID:12634122 Matk Rat dioxygen decreases expression ISO Matk (Mus musculus) 6480464 Oxygen deficiency results in decreased expression of MATK mRNA CTD PMID:24205000 Matk Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of MATK mRNA CTD PMID:33729688 Matk Rat disodium selenite increases expression ISO MATK (Homo sapiens) 6480464 Sodium Selenite results in increased expression of MATK mRNA CTD PMID:18175754 Matk Rat dorsomorphin multiple interactions ISO MATK (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Matk Rat entinostat increases expression ISO MATK (Homo sapiens) 6480464 entinostat results in increased expression of MATK mRNA CTD PMID:27188386 Matk Rat ethanol affects splicing ISO Matk (Mus musculus) 6480464 Ethanol affects the splicing of MATK mRNA CTD PMID:30319688 Matk Rat ethylparaben decreases expression ISO MATK (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in decreased expression of MATK mRNA CTD PMID:37690743 Matk Rat folic acid multiple interactions ISO Matk (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of MATK mRNA CTD PMID:20938992 Matk Rat folic acid increases expression ISO Matk (Mus musculus) 6480464 Folic Acid results in increased expression of MATK mRNA CTD PMID:25629700 Matk Rat fonofos increases methylation ISO MATK (Homo sapiens) 6480464 Fonofos results in increased methylation of MATK promoter CTD PMID:22847954 Matk Rat FR900359 increases phosphorylation ISO MATK (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of MATK protein CTD PMID:37730182 Matk Rat furan increases expression EXP 6480464 furan results in increased expression of MATK mRNA CTD PMID:27387713 Matk Rat genistein increases expression ISO MATK (Homo sapiens) 6480464 Genistein results in increased expression of MATK mRNA CTD PMID:23019147 Matk Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of MATK mRNA CTD PMID:20080153 Matk Rat L-methionine multiple interactions ISO Matk (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of MATK mRNA CTD PMID:20938992 Matk Rat lead diacetate multiple interactions ISO MATK (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of MATK mRNA CTD PMID:12634122 Matk Rat lead(0) affects expression ISO MATK (Homo sapiens) 6480464 Lead affects the expression of MATK mRNA CTD PMID:28903495 Matk Rat lipopolysaccharide multiple interactions ISO MATK (Homo sapiens) 6480464 [TNFSF11 protein results in increased susceptibility to Lipopolysaccharides] which results in increased expression of MATK protein more ... CTD PMID:27718290 Matk Rat p-chloromercuribenzoic acid decreases expression ISO MATK (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in decreased expression of MATK mRNA CTD PMID:26272509 Matk Rat p-chloromercuribenzoic acid multiple interactions ISO MATK (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MATK mRNA CTD PMID:27188386 Matk Rat paclitaxel multiple interactions ISO MATK (Homo sapiens) 6480464 [Cisplatin co-treated with Paclitaxel] results in decreased expression of MATK mRNA CTD PMID:20705681 Matk Rat paracetamol decreases expression ISO Matk (Mus musculus) 6480464 Acetaminophen results in decreased expression of MATK mRNA CTD PMID:17585979 Matk Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of MATK mRNA CTD PMID:32680482 Matk Rat parathion increases methylation ISO MATK (Homo sapiens) 6480464 Parathion results in increased methylation of MATK promoter CTD PMID:22847954 Matk Rat phenylmercury acetate decreases expression ISO MATK (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of MATK mRNA CTD PMID:26272509 Matk Rat phenylmercury acetate multiple interactions ISO MATK (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MATK mRNA CTD PMID:27188386 Matk Rat potassium dichromate increases expression ISO MATK (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of MATK mRNA CTD PMID:11678601 Matk Rat progesterone increases expression ISO MATK (Homo sapiens) 6480464 Progesterone results in increased expression of MATK mRNA and Progesterone results in increased expression of MATK protein CTD PMID:17492661 Matk Rat SB 431542 multiple interactions ISO MATK (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Matk Rat sodium arsenite multiple interactions ISO MATK (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of MATK mRNA CTD PMID:12634122 Matk Rat sodium arsenite increases expression ISO MATK (Homo sapiens) 6480464 sodium arsenite results in increased expression of MATK mRNA CTD PMID:34032870 and PMID:38568856 Matk Rat terbufos increases methylation ISO MATK (Homo sapiens) 6480464 terbufos results in increased methylation of MATK promoter CTD PMID:22847954 Matk Rat testosterone increases expression ISO MATK (Homo sapiens) 6480464 Testosterone results in increased expression of MATK mRNA CTD PMID:33359661 Matk Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of MATK mRNA CTD PMID:34492290 Matk Rat titanium dioxide increases methylation ISO Matk (Mus musculus) 6480464 titanium dioxide results in increased methylation of MATK promoter CTD PMID:35295148 Matk Rat triphenyl phosphate affects expression ISO MATK (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MATK mRNA CTD PMID:37042841 Matk Rat triptonide affects expression ISO Matk (Mus musculus) 6480464 triptonide affects the expression of MATK mRNA CTD PMID:33045310 Matk Rat valproic acid affects expression ISO MATK (Homo sapiens) 6480464 Valproic Acid affects the expression of MATK mRNA CTD PMID:25979313 Matk Rat valproic acid increases methylation ISO MATK (Homo sapiens) 6480464 Valproic Acid results in increased methylation of MATK gene CTD PMID:29154799
(2,4,5-trichlorophenoxy)acetic acid (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-aminopurine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP) bisphenol F (EXP,ISO) cadmium dichloride (ISO) calcium silicate (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (ISO) copper(II) sulfate (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dichromium trioxide (ISO) dioxygen (EXP,ISO) disodium selenite (ISO) dorsomorphin (ISO) entinostat (ISO) ethanol (ISO) ethylparaben (ISO) folic acid (ISO) fonofos (ISO) FR900359 (ISO) furan (EXP) genistein (ISO) ketamine (EXP) L-methionine (ISO) lead diacetate (ISO) lead(0) (ISO) lipopolysaccharide (ISO) p-chloromercuribenzoic acid (ISO) paclitaxel (ISO) paracetamol (ISO) paraquat (EXP) parathion (ISO) phenylmercury acetate (ISO) potassium dichromate (ISO) progesterone (ISO) SB 431542 (ISO) sodium arsenite (ISO) terbufos (ISO) testosterone (ISO) thioacetamide (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Identification and characterization of Batk, a predominantly brain-specific non-receptor protein tyrosine kinase related to Csk.
Kuo SS, etal., J Neurosci Res 1994 Aug 15;38(6):705-15.
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
GOA pipeline
RGD automated data pipeline
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Localization of 54 rat genes, and definition of new synteny groups conserved in the human and the rat.
Szpirer C, etal., Mamm Genome 2000 Sep;11(9):729-35
9.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
Matk Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 9,107,711 - 9,116,864 (-) NCBI GRCr8 mRatBN7.2 7 8,456,990 - 8,465,947 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 8,456,998 - 8,462,022 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 11,341,194 - 11,346,217 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 13,216,677 - 13,221,700 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 11,084,145 - 11,089,168 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 11,325,246 - 11,334,311 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 11,325,254 - 11,330,278 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 11,492,654 - 11,498,451 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 9,940,799 - 9,945,824 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 9,940,799 - 9,945,824 (-) NCBI Celera 7 6,645,321 - 6,650,346 (-) NCBI Celera Cytogenetic Map 7 q11 NCBI
MATK Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 3,777,973 - 3,801,799 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 3,777,970 - 3,802,129 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 3,777,971 - 3,801,797 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 3,728,967 - 3,752,810 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 3,728,967 - 3,737,414 NCBI Celera 19 3,715,610 - 3,739,451 (-) NCBI Celera Cytogenetic Map 19 p13.3 NCBI HuRef 19 3,542,732 - 3,566,615 (-) NCBI HuRef CHM1_1 19 3,777,602 - 3,801,471 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 3,757,233 - 3,781,064 (-) NCBI T2T-CHM13v2.0
Matk Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 81,088,769 - 81,098,819 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 81,088,769 - 81,099,199 (+) Ensembl GRCm39 Ensembl GRCm38 10 81,252,935 - 81,262,985 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 81,252,935 - 81,263,365 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 80,720,290 - 80,725,726 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 80,660,674 - 80,666,110 (+) NCBI MGSCv36 mm8 Celera 10 82,277,893 - 82,283,329 (+) NCBI Celera Cytogenetic Map 10 C1 NCBI cM Map 10 39.72 NCBI
Matk Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955495 5,663,768 - 5,669,654 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955495 5,663,768 - 5,670,113 (-) NCBI ChiLan1.0 ChiLan1.0
MATK Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 8,173,450 - 8,197,415 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 7,401,700 - 7,429,045 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 2,800,301 - 2,825,311 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 3,750,256 - 3,758,272 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 3,750,256 - 3,757,385 (-) Ensembl panpan1.1 panPan2
MATK Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 55,697,377 - 55,704,212 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 55,698,350 - 55,704,022 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 55,422,757 - 55,429,545 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 56,357,401 - 56,364,179 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 56,357,860 - 56,365,740 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 55,413,344 - 55,420,706 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 55,895,262 - 55,902,025 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 56,094,009 - 56,100,857 (+) NCBI UU_Cfam_GSD_1.0
Matk Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 215,689,105 - 215,696,796 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936588 2,137,663 - 2,144,512 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936588 2,137,987 - 2,144,274 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MATK
MATK Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 3,533,363 - 3,542,034 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 3,533,236 - 3,542,011 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666081 4,707,784 - 4,716,456 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Matk
.
Predicted Target Of
Count of predictions: 67 Count of miRNA genes: 61 Interacting mature miRNAs: 66 Transcripts: ENSRNOT00000027730 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1300176 Hrtrt10 Heart rate QTL 10 3.19 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 664270 26029351 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 9590142 Scort5 Serum corticosterone level QTL 5 24.4 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 1 31962314 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 2298550 Neuinf6 Neuroinflammation QTL 6 3.3 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 7 1 27829089 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 7411566 Bw136 Body weight QTL 136 10.4 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 1 31962314 Rat
G67866
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 8,458,271 - 8,458,512 (+) MAPPER mRatBN7.2 Rnor_6.0 7 11,326,528 - 11,326,768 NCBI Rnor6.0 Rnor_5.0 7 11,493,936 - 11,494,176 UniSTS Rnor5.0 RGSC_v3.4 7 9,942,074 - 9,942,314 UniSTS RGSC3.4 Celera 7 6,646,596 - 6,646,836 UniSTS Cytogenetic Map 7 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000027730 ⟹ ENSRNOP00000027730
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 8,456,998 - 8,462,022 (-) Ensembl Rnor_6.0 Ensembl 7 11,325,254 - 11,330,278 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000112957 ⟹ ENSRNOP00000096637
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 8,456,998 - 8,461,774 (-) Ensembl
RefSeq Acc Id:
NM_021859 ⟹ NP_068631
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,107,721 - 9,112,746 (-) NCBI mRatBN7.2 7 8,456,997 - 8,462,022 (-) NCBI Rnor_6.0 7 11,325,253 - 11,330,278 (-) NCBI Rnor_5.0 7 11,492,654 - 11,498,451 (-) NCBI RGSC_v3.4 7 9,940,799 - 9,945,824 (-) RGD Celera 7 6,645,321 - 6,650,346 (-) RGD
Sequence:
CCAGCCAGGGACCCAGGCAGCCACAGTCCTGCGGTGCCGCACTGGGATGGGGTGAACCCTCAATTCTAAGGAGCTTGGCACCCCACGCCTGCTGCAGCTAAGATGCCAACGCAACGCTGGGCCCCTGG
hide sequence
RefSeq Acc Id:
XM_039079841 ⟹ XP_038935769
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,107,711 - 9,113,389 (-) NCBI mRatBN7.2 7 8,456,990 - 8,462,665 (-) NCBI
RefSeq Acc Id:
XM_039079842 ⟹ XP_038935770
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,107,711 - 9,116,864 (-) NCBI mRatBN7.2 7 8,456,990 - 8,465,947 (-) NCBI
RefSeq Acc Id:
XM_039079843 ⟹ XP_038935771
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,107,711 - 9,112,658 (-) NCBI mRatBN7.2 7 8,456,990 - 8,461,917 (-) NCBI
RefSeq Acc Id:
XM_039079844 ⟹ XP_038935772
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,107,711 - 9,112,985 (-) NCBI mRatBN7.2 7 8,456,990 - 8,462,257 (-) NCBI
RefSeq Acc Id:
XM_039079845 ⟹ XP_038935773
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,107,711 - 9,113,389 (-) NCBI mRatBN7.2 7 8,456,990 - 8,462,665 (-) NCBI
RefSeq Acc Id:
XM_063264199 ⟹ XP_063120269
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,107,711 - 9,113,389 (-) NCBI
RefSeq Acc Id:
XM_063264200 ⟹ XP_063120270
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,107,711 - 9,116,864 (-) NCBI
RefSeq Acc Id:
XM_063264201 ⟹ XP_063120271
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,107,711 - 9,113,389 (-) NCBI
RefSeq Acc Id:
NP_068631 ⟸ NM_021859
- UniProtKB:
P41243 (UniProtKB/Swiss-Prot), A6K8A4 (UniProtKB/TrEMBL), A0A8I6GLP3 (UniProtKB/TrEMBL)
- Sequence:
MPTQRWAPGTQCMTKCENSRPKPGELAFRKGDMVTILEACEDKSWYRAKHHSSGQEGLLAAAALRQREALSTDPKLSLMPWFHGKISGQEAIQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHY
hide sequence
Ensembl Acc Id:
ENSRNOP00000027730 ⟸ ENSRNOT00000027730
RefSeq Acc Id:
XP_038935770 ⟸ XM_039079842
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6GLP3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935773 ⟸ XM_039079845
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6GLP3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935769 ⟸ XM_039079841
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6GLP3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935772 ⟸ XM_039079844
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6GLP3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935771 ⟸ XM_039079843
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6GLP3 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000096637 ⟸ ENSRNOT00000112957
RefSeq Acc Id:
XP_063120270 ⟸ XM_063264200
- Peptide Label:
isoform X3
- UniProtKB:
P41243 (UniProtKB/Swiss-Prot), A6K8A4 (UniProtKB/TrEMBL), A0A8I6GLP3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120271 ⟸ XM_063264201
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6GLP3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120269 ⟸ XM_063264199
- Peptide Label:
isoform X3
- UniProtKB:
P41243 (UniProtKB/Swiss-Prot), A6K8A4 (UniProtKB/TrEMBL), A0A8I6GLP3 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Matk
megakaryocyte-associated tyrosine kinase
Name updated
70584 APPROVED
2002-02-20
Matk
Megakaryocyte-associated tyrosine kinase
Name updated to reflect Human and Mouse nomenclature
70282 APPROVED
Note Type
Note
Reference
gene_process
may be involved in regulating brain development
68875
