Symbol:
Neurog3
Name:
neurogenin 3
RGD ID:
631350
Description:
Enables DNA-binding transcription activator activity, RNA polymerase II-specific and double-stranded DNA binding activity. Involved in central nervous system development; positive regulation of neuron differentiation; and regulation of DNA-templated transcription. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in congenital malabsorptive diarrhea 4; glucose intolerance; and type 2 diabetes mellitus. Orthologous to human NEUROG3 (neurogenin 3); PARTICIPATES IN maturity-onset diabetes of the young pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3H-1,2-dithiole-3-thione; ammonium chloride.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
neurogenin-3; Ngn3; Relax; transcriptional regulator, Relax
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NEUROG3 (neurogenin 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Neurog3 (neurogenin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Neurog3 (neurogenin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NEUROG3 (neurogenin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NEUROG3 (neurogenin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Neurog3 (neurogenin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NEUROG3 (neurogenin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NEUROG3 (neurogenin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Neurog3 (neurogenin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
NEUROG3 (neurogenin 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Neurog3 (neurogenin 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
neurog3 (neurogenin 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ngn-1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
tap
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
neurog3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 30,622,533 - 30,624,015 (+) NCBI GRCr8 mRatBN7.2 20 30,079,780 - 30,081,262 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 30,079,780 - 30,081,262 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 31,090,729 - 31,092,211 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 30,481,622 - 30,483,104 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 31,224,416 - 31,225,898 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 31,761,419 - 31,762,893 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 31,761,405 - 31,762,893 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 33,556,854 - 33,558,331 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 29,522,778 - 29,524,261 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 29,536,585 - 29,538,061 (+) NCBI Celera 20 31,503,365 - 31,504,847 (+) NCBI Celera Cytogenetic Map 20 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Annotations - KEGG (archival)
1.
Ngn3 expression during postnatal in vitro beta cell neogenesis induced by the JAK/STAT pathway.
Baeyens L, etal., Cell Death Differ. 2006 Nov;13(11):1892-9. Epub 2006 Mar 3.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Polymorphic variations in the neurogenic differentiation-1, neurogenin-3, and hepatocyte nuclear factor-1alpha genes contribute to glucose intolerance in a South Indian population.
Jackson AE, etal., Diabetes. 2004 Aug;53(8):2122-5.
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
NEUROG3 variants and type 2 diabetes in Italians.
Milord E and Gragnoli C, Minerva Med. 2006 Oct;97(5):373-8.
6.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
7.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
8.
Relax, a novel rat bHLH transcriptional regulator transiently expressed in the ventricular proliferating zone of the developing central nervous system.
Ravassard P, etal., J Neurosci Res 1997 Apr 15;48(2):146-58.
9.
Relax promotes ectopic neuronal differentiation in Xenopus embryos.
Ravassard P, etal., Proc Natl Acad Sci U S A. 1997 Aug 5;94(16):8602-5.
10.
GOA pipeline
RGD automated data pipeline
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Islet cell differentiation in liver by combinatorial expression of transcription factors neurogenin-3, BETA2, and RIPE3b1.
Song YD, etal., Biochem Biophys Res Commun. 2007 Mar 9;354(2):334-9. Epub 2007 Jan 10.
14.
Gene Therapy with Neurogenin 3 and Betacellulin Reverses Major Metabolic Problems in Insulin-Deficient Diabetic Mice.
Yechoor V, etal., Endocrinology. 2009 Oct 9.
Neurog3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 30,622,533 - 30,624,015 (+) NCBI GRCr8 mRatBN7.2 20 30,079,780 - 30,081,262 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 30,079,780 - 30,081,262 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 31,090,729 - 31,092,211 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 30,481,622 - 30,483,104 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 31,224,416 - 31,225,898 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 31,761,419 - 31,762,893 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 31,761,405 - 31,762,893 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 33,556,854 - 33,558,331 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 29,522,778 - 29,524,261 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 29,536,585 - 29,538,061 (+) NCBI Celera 20 31,503,365 - 31,504,847 (+) NCBI Celera Cytogenetic Map 20 q11 NCBI
NEUROG3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 69,571,485 - 69,573,422 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 69,571,698 - 69,573,422 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 71,331,454 - 71,333,178 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 71,001,797 - 71,003,128 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 71,001,796 - 71,003,128 NCBI Celera 10 64,608,651 - 64,610,070 (-) NCBI Celera Cytogenetic Map 10 q22.1 NCBI HuRef 10 65,321,715 - 65,323,132 (-) NCBI HuRef CHM1_1 10 71,613,524 - 71,614,943 (-) NCBI CHM1_1 T2T-CHM13v2.0 10 70,439,446 - 70,441,420 (-) NCBI T2T-CHM13v2.0
Neurog3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 61,968,869 - 61,970,542 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 61,968,869 - 61,970,542 (+) Ensembl GRCm39 Ensembl GRCm38 10 62,133,090 - 62,134,763 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 62,133,090 - 62,134,763 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 61,595,838 - 61,597,511 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 61,528,447 - 61,530,120 (+) NCBI MGSCv36 mm8 Celera 10 63,235,605 - 63,237,278 (+) NCBI Celera Cytogenetic Map 10 B4 NCBI cM Map 10 32.35 NCBI
Neurog3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955437 21,577,896 - 21,578,546 (+) NCBI ChiLan1.0 ChiLan1.0
NEUROG3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 81,720,280 - 81,721,303 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 81,725,601 - 81,726,624 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 66,039,739 - 66,041,804 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 68,571,204 - 68,572,663 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 68,571,614 - 68,572,258 (-) Ensembl panpan1.1 panPan2
NEUROG3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 20,654,824 - 20,657,816 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 20,656,791 - 20,657,438 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 20,784,524 - 20,787,459 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 20,926,422 - 20,929,357 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 20,928,319 - 20,928,966 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 20,825,760 - 20,828,692 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 21,030,322 - 21,033,256 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 21,374,244 - 21,377,179 (-) NCBI UU_Cfam_GSD_1.0
Neurog3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 60,438,787 - 60,440,954 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936521 8,932,998 - 8,933,645 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936521 8,932,998 - 8,933,645 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NEUROG3
NEUROG3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 61,743,562 - 61,746,884 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 61,744,332 - 61,744,979 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 22,483,580 - 22,484,779 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Neurog3
.
Predicted Target Of
Count of predictions: 160 Count of miRNA genes: 125 Interacting mature miRNAs: 147 Transcripts: ENSRNOT00000000661 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4889610 Pancm3 Pancreatic morphology QTL 3 3.75 0.001 pancreas mass (VT:0010144) pancreas wet weight (CMO:0000626) 20 17617832 47606836 Rat 2303587 Bw93 Body weight QTL 93 13 body mass (VT:0001259) body weight (CMO:0000012) 20 25106722 54435887 Rat 1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 2303626 Vencon10 Ventilatory control QTL 10 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 20 19190721 54435887 Rat 1598869 Memor6 Memory QTL 6 3.1 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 20 29244388 54435887 Rat 7411652 Foco24 Food consumption QTL 24 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 11757515 54435887 Rat 1331747 Hrtrt16 Heart rate QTL 16 3.163 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 20 25209734 54435887 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 2303578 Gluco50 Glucose level QTL 50 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 20 25106722 54435887 Rat 2317880 Alcrsp25 Alcohol response QTL 25 2.3 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 17697550 54435887 Rat 6893685 Bw111 Body weight QTL 111 2.7 0.004 body mass (VT:0001259) body weight (CMO:0000012) 20 1 32578807 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat 9590092 Insglur9 Insulin/glucose ratio QTL 9 18.38 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 20 11757515 54435887 Rat 2300188 Bmd68 Bone mineral density QTL 68 6.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 20 25106722 54435887 Rat
PMC85623P2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 30,080,643 - 30,080,876 (+) MAPPER mRatBN7.2 Rnor_6.0 20 31,762,275 - 31,762,507 NCBI Rnor6.0 Rnor_5.0 20 33,557,713 - 33,557,945 UniSTS Rnor5.0 RGSC_v3.4 20 29,523,643 - 29,523,875 UniSTS RGSC3.4 Celera 20 31,504,229 - 31,504,461 UniSTS Cytogenetic Map 20 q11 UniSTS
UniSTS:462689
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 30,080,312 - 30,080,870 (+) MAPPER mRatBN7.2 Rnor_6.0 20 31,761,944 - 31,762,501 NCBI Rnor6.0 Rnor_5.0 20 33,557,382 - 33,557,939 UniSTS Rnor5.0 RGSC_v3.4 20 29,523,312 - 29,523,869 UniSTS RGSC3.4 Celera 20 31,503,898 - 31,504,455 UniSTS Cytogenetic Map 20 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
1
27
6
21
4
3
4
35
3
27
18
23
17
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000000661 ⟹ ENSRNOP00000000661
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 30,079,780 - 30,081,262 (+) Ensembl Rnor_6.0 Ensembl 20 31,761,405 - 31,762,893 (+) Ensembl
RefSeq Acc Id:
NM_021700 ⟹ NP_067732
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 30,622,533 - 30,624,015 (+) NCBI mRatBN7.2 20 30,079,780 - 30,081,262 (+) NCBI Rnor_6.0 20 31,761,419 - 31,762,893 (+) NCBI Rnor_5.0 20 33,556,854 - 33,558,331 (+) NCBI RGSC_v3.4 20 29,522,778 - 29,524,261 (+) RGD Celera 20 31,503,365 - 31,504,847 (+) RGD
Sequence:
GCAGGTAGCGAGAGGAGCAGTCCCTGGGCCCCCGTTGCTGATTGGCCCGTGGCACAGGCAGCAGCCCGGCAGGCACGCTCCTGGTCCGGGCAGAGCAGATAAAGCGTGCCAGGGGACACACGATTAGC
hide sequence
RefSeq Acc Id:
NP_067732 ⟸ NM_021700
- UniProtKB:
O08718 (UniProtKB/TrEMBL), F7EPK2 (UniProtKB/TrEMBL)
- Sequence:
MAPHPLDAPTIQVSQETQQPFPGASDHEVLSSNSTPPSPTLVPRDCSEAEAGDCRGTSRKLRARRGGRNRPKSELALSKQRRSRRKKANDRERNRMHNLNSALDALRGVLPTFPDDAKLTKIETLRFA
hide sequence
Ensembl Acc Id:
ENSRNOP00000000661 ⟸ ENSRNOT00000000661
RGD ID: 13701609 Promoter ID: EPDNEW_R12133 Type: single initiation site Name: Neurog3_1 Description: neurogenin 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 31,761,395 - 31,761,455 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Neurog3
neurogenin 3
transcriptional regulator, Relax
Name updated
1299863 APPROVED
2004-09-10
Neurog3
transcriptional regulator, Relax
Ngn3
Symbol and Name updated
1299863 APPROVED
Note Type
Note
Reference
gene_expression
expressed exclusively in the central nervous system
633362
