Advanced Search (OLGA)

Gene: Neurog3 (neurogenin 3) Chinchilla lanigera

Analyze

Symbol:

Neurog3

Name:

neurogenin 3

RGD ID:

9016817

Description:

ENCODES a protein that exhibits chromatin DNA binding (ortholog); DNA-binding transcription activator activity, RNA polymerase II-specific (ortholog); DNA-binding transcription factor activity (ortholog); INVOLVED IN enteroendocrine cell differentiation (ortholog); epithelial cell differentiation (ortholog); forebrain development (ortholog); ASSOCIATED WITH anemia (ortholog); cholelithiasis (ortholog); congenital malabsorptive diarrhea 4 (ortholog); FOUND IN nucleus (ortholog)

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

neurogenin-3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NEUROG3 (neurogenin 3)	NCBI	Ortholog
Mus musculus (house mouse):	Neurog3 (neurogenin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):	Neurog3 (neurogenin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NEUROG3 (neurogenin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NEUROG3 (neurogenin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Neurog3 (neurogenin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NEUROG3 (neurogenin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NEUROG3 (neurogenin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Neurog3 (neurogenin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Neurog3 (neurogenin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline

Latest Assembly:

ChiLan1.0 - Chinchilla ChiLan1.0 Assembly

Position:

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955437	21,577,896 - 21,578,546 (+)	NCBI	ChiLan1.0	ChiLan1.0

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

anemia (ISO)

cholelithiasis (ISO)

congenital malabsorptive diarrhea 4 (ISO)

Developmental Disabilities (ISO)

diarrhea (ISO)

exocrine pancreatic insufficiency (ISO)

Experimental Diabetes Mellitus (ISO)

genetic disease (ISO)

gestational diabetes (ISO)

glucose intolerance (ISO)

hyperglycemia (ISO)

Hyperoxaluria (ISO)

nephrocalcinosis (ISO)

type 1 diabetes mellitus (ISO)

type 2 diabetes mellitus (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

enteroendocrine cell differentiation (ISO)

epithelial cell differentiation (ISO)

forebrain development (ISO)

hindbrain development (ISO)

negative regulation of transcription by RNA polymerase II (ISO)

positive regulation of cell differentiation (ISO)

positive regulation of DNA-templated transcription (ISO)

positive regulation of neuron differentiation (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

regulation of dendrite morphogenesis (ISO)

regulation of DNA-templated transcription (ISO)

spinal cord development (ISO)

transdifferentiation (ISO)

Cellular Component

nucleus (ISO)

Molecular Function

chromatin DNA binding (ISO)

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO)

DNA-binding transcription factor activity (ISO)

DNA-binding transcription repressor activity, RNA polymerase II-specific (ISO)

double-stranded DNA binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Transitive Annotation Pipeline	Automated assignment of GO, PW and RDO ISO annotations across species
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline

Additional References at PubMed

PMID:22301074

Genomics

Comparative Map Data

Neurog3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955437	21,577,896 - 21,578,546 (+)	NCBI	ChiLan1.0	ChiLan1.0

NEUROG3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	69,571,485 - 69,573,422 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	69,571,485 - 69,573,511 (-)	Ensembl		GRCh38.p14 Ensembl	hg38	GRCh38
GRCh37	10	71,331,454 - 71,333,178 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	71,001,797 - 71,003,128 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	71,001,796 - 71,003,128	NCBI
Celera	10	64,608,651 - 64,610,070 (-)	NCBI		Celera
Cytogenetic Map	10	q22.1	NCBI
HuRef	10	65,321,715 - 65,323,132 (-)	NCBI		HuRef
CHM1_1	10	71,613,524 - 71,614,943 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	10	70,439,446 - 70,441,420 (-)	NCBI		T2T-CHM13v2.0

Neurog3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	61,968,869 - 61,970,542 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	61,968,862 - 61,970,766 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	10	62,133,090 - 62,134,763 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	62,133,090 - 62,134,763 (+)	Ensembl		GRCm38.p6 Ensembl	mm10	GRCm38
MGSCv37	10	61,595,838 - 61,597,511 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	10	61,528,447 - 61,530,120 (+)	NCBI		MGSCv36	mm8
Celera	10	63,235,605 - 63,237,278 (+)	NCBI		Celera
Cytogenetic Map	10	B4	NCBI
cM Map	10	32.35	NCBI

Neurog3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	30,622,533 - 30,624,015 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	30,622,533 - 30,624,015 (+)	Ensembl				GRCr8
mRatBN7.2	20	30,079,780 - 30,081,262 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	30,079,780 - 30,081,262 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	31,090,729 - 31,092,211 (+)	NCBI	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	30,481,622 - 30,483,104 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	31,224,416 - 31,225,898 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	20	30,648,634 - 30,650,116 (+)	NCBI
Lyon_Normotensive	20	31,689,484 - 31,690,966 (+)	NCBI
Lyon_Hypertensive	20	31,727,294 - 31,728,776 (+)	NCBI
F344_StmMcwi	20	30,588,625 - 30,590,107 (+)	NCBI
Rnor_6.0	20	31,761,419 - 31,762,893 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	31,761,405 - 31,762,893 (+)	Ensembl		Rnor_6.0 Ensembl	rn6	Rnor6.0
Rnor_5.0	20	33,556,854 - 33,558,331 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	20	29,522,778 - 29,524,261 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	20	31,503,365 - 31,504,847 (+)	NCBI		Celera
RGSC_v3.1	20	29,536,585 - 29,538,061 (+)	NCBI
Cytogenetic Map	20	q11	NCBI

NEUROG3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	81,720,280 - 81,721,303 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	81,725,601 - 81,726,624 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	66,039,739 - 66,041,804 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	68,571,204 - 68,572,663 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	68,571,614 - 68,572,258 (-)	Ensembl		PanPan1.1 Ensembl	panPan2	panpan1.1

NEUROG3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	20,654,824 - 20,657,816 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	20,656,791 - 20,657,438 (-)	Ensembl		CanFam3.1 Ensembl	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	20,784,524 - 20,787,459 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	20,926,422 - 20,929,357 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	20,928,319 - 20,928,966 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	20,825,760 - 20,828,692 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	21,030,322 - 21,033,256 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	21,374,244 - 21,377,179 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Neurog3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mIctTri1.hap1	1	52,152,683 - 52,153,382 (+)	NCBI		mIctTri1.hap1
HiC_Itri_2	NW_024407213	60,438,787 - 60,440,954 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936521	8,932,998 - 8,933,645 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936521	8,932,998 - 8,933,645 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NEUROG3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	72,604,467 - 72,606,360 (-)	Ensembl		Sscrofa11.1 Ensembl	susScr11	Sscrofa11.1
Sscrofa11.1	14	72,604,203 - 72,606,362 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

NEUROG3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mChlSab1.0.hap1	9	70,906,427 - 70,907,432 (+)	NCBI		mChlSab1.0.hap1
Vero_WHO_p1.0	NW_023666048	22,483,580 - 22,484,779 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0
ChlSab1.1	9	61,743,562 - 61,746,884 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	61,744,332 - 61,744,979 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM

Neurog3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624754	3,817,400 - 3,818,047 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Neurog3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	18	27,957,685 - 27,959,552 (+)	NCBI	Rrattus_CSIRO_v1	Rrattus_CSIRO_v1

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	XM_005390082	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AGCD01034911	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

XM_005390082 ⟹ XP_005390139

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0	NW_004955437	21,577,896 - 21,578,546 (+)	NCBI

Sequence:

show sequence

ATGGCGCCTCACCCTTTGGGTGTGCCCTCTATCCAAGTGACCTGTGAGACCGAGCAGTCCTTCT
CTGGAGCCTCAAACAACGAAATACCGAAGGCCGCGTCTGCCCCACCCAGCCCCACGCTCATGTC
CCGGGACTGTGCGGAGCCAGAAGCAGGCGGCTGCCGAGGGGCTGCGAGGAAGCTTCGCGCGCGG
CGCGGAGGGCGCAGCCGGCCCAAGAGCGAGTTGGCGCTGAGCAAGCAGAGACGGAGTCGGCGCA
AGAAAGCCAACGACCGCGAGCGCAATCGGATGCACAACCTCAACTCCGCACTGGACGCGCTGCG
CAGTGTCCTGCCCACCTTCCCGGATGACGCGAAGCTCACCAAGATCGAGACGCTGCGCTTTGCT
CACAACTACATCTGGGCACTGACTCAGACGCTGCGCATAGCGGACCACAGCTTCTATGGGCGGG
AGCTGCCCGCGGGGACGTCCTGCGGGGAGGTGGGCAGCCCCGCTGGCGGCTCCACTGGTGACTG
GGGCTCCCTCTACTCCCCAGTTTCCCACGCTGGCAGCCTGAGCCCCGACGCCTCGTTAGAGGAG
CGCCCCGGGCTTGGGGCGCCTACCTCCCCTCCCTGCCTGCCTCCTGGCGCCTTGGCCTTCTCAG
ACTTCCTGTGA

hide sequence

Protein Sequences


Protein RefSeqs	XP_005390139	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

XP_005390139 ⟸ XM_005390082

- Sequence:

show sequence

MAPHPLGVPSIQVTCETEQSFSGASNNEIPKAASAPPSPTLMSRDCAEPEAGGCRGAARKLRAR
RGGRSRPKSELALSKQRRSRRKKANDRERNRMHNLNSALDALRSVLPTFPDDAKLTKIETLRFA
HNYIWALTQTLRIADHSFYGRELPAGTSCGEVGSPAGGSTGDWGSLYSPVSHAGSLSPDASLEE
RPGLGAPTSPPCLPPGALAFSDFL

hide sequence

Additional Information

External Database Links

Database	Acc Id	Source(s)
NCBI Gene	Neurog3	ENTREZGENE

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM