Symbol:
Faim2
Name:
Fas apoptotic inhibitory molecule 2
RGD ID:
628744
Description:
Predicted to enable calcium channel activity. Predicted to be involved in apoptotic signaling pathway; cerebellar cortex development; and negative regulation of apoptotic process. Predicted to act upstream of or within negative regulation of apoptotic signaling pathway and response to ischemia. Predicted to be located in Golgi membrane and membrane raft. Predicted to be active in Golgi apparatus; endoplasmic reticulum; and membrane. Biomarker of chronic obstructive pulmonary disease. Orthologous to human FAIM2 (Fas apoptotic inhibitory molecule 2); PARTICIPATES IN FasL mediated signaling pathway; INTERACTS WITH 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Lfg; lifeguard; LOC102551901; MGC105316; neural membrane protein 35; NMP35; protein lifeguard 2; protein lifeguard 2-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 132,512,095 - 132,539,192 (-) NCBI GRCr8 mRatBN7.2 7 130,632,368 - 130,659,353 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 130,633,348 - 130,659,168 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 132,436,973 - 132,462,777 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 134,662,553 - 134,688,359 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 134,575,068 - 134,600,878 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 141,158,769 - 141,185,781 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 141,157,963 - 141,185,710 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 115,663,275 - 115,689,093 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 138,246,372 - 138,272,190 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 138,322,809 - 138,348,627 (-) NCBI Celera 7 127,115,377 - 127,141,090 (-) NCBI Celera Cytogenetic Map 7 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Faim2 Rat 1,2-dimethylhydrazine decreases expression ISO Faim2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of FAIM2 mRNA CTD PMID:22206623 Faim2 Rat 17beta-estradiol decreases expression ISO FAIM2 (Homo sapiens) 6480464 Estradiol results in decreased expression of FAIM2 mRNA CTD PMID:23373633 Faim2 Rat 17beta-estradiol increases expression ISO Faim2 (Mus musculus) 6480464 Estradiol results in increased expression of FAIM2 mRNA CTD PMID:19693291 Faim2 Rat 17beta-estradiol 3-benzoate decreases methylation EXP 6480464 estradiol 3-benzoate results in decreased methylation of FAIM2 promoter CTD PMID:27415467 Faim2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Faim2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Faim2 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Faim2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Faim2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of FAIM2 mRNA CTD PMID:32109520 Faim2 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Faim2 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Faim2 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Faim2 Rat 2-hydroxypropanoic acid decreases expression ISO FAIM2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of FAIM2 mRNA CTD PMID:30851411 Faim2 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO Faim2 (Mus musculus) 6480464 tetrabromobisphenol A results in increased expression of FAIM2 mRNA CTD PMID:25172293 Faim2 Rat 4,4'-sulfonyldiphenol decreases expression ISO FAIM2 (Homo sapiens) 6480464 bisphenol S results in decreased expression of FAIM2 mRNA CTD PMID:27685785 Faim2 Rat 4,4'-sulfonyldiphenol increases methylation ISO Faim2 (Mus musculus) 6480464 bisphenol S results in increased methylation of FAIM2 exon CTD PMID:33297965 Faim2 Rat acrolein decreases expression ISO Faim2 (Mus musculus) 6480464 Acrolein results in decreased expression of FAIM2 mRNA CTD PMID:18515264 Faim2 Rat acrylamide increases expression ISO FAIM2 (Homo sapiens) 6480464 Acrylamide results in increased expression of FAIM2 mRNA CTD PMID:32763439 Faim2 Rat afimoxifene decreases expression ISO FAIM2 (Homo sapiens) 6480464 afimoxifene results in decreased expression of FAIM2 mRNA CTD PMID:23373633 Faim2 Rat aflatoxin B1 increases methylation ISO FAIM2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of FAIM2 intron CTD PMID:30157460 Faim2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of FAIM2 mRNA CTD PMID:16483693 Faim2 Rat arsane decreases methylation ISO FAIM2 (Homo sapiens) 6480464 Arsenic results in decreased methylation of FAIM2 3' UTR CTD PMID:31135185 Faim2 Rat arsenic atom decreases methylation ISO FAIM2 (Homo sapiens) 6480464 Arsenic results in decreased methylation of FAIM2 3' UTR CTD PMID:31135185 Faim2 Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of FAIM2 mRNA CTD PMID:36841081 Faim2 Rat beauvericin increases expression ISO FAIM2 (Homo sapiens) 6480464 beauvericin results in increased expression of FAIM2 mRNA CTD PMID:29203277 Faim2 Rat benzo[a]pyrene increases methylation ISO FAIM2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of FAIM2 3' UTR CTD PMID:27901495 Faim2 Rat benzo[a]pyrene affects methylation ISO FAIM2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of FAIM2 intron CTD PMID:30157460 Faim2 Rat beta-carotene increases expression ISO FAIM2 (Homo sapiens) 6480464 beta Carotene results in increased expression of FAIM2 mRNA CTD PMID:17034753 Faim2 Rat beta-lapachone decreases expression ISO FAIM2 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of FAIM2 mRNA CTD PMID:38218311 Faim2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of FAIM2 mRNA CTD PMID:25181051 Faim2 Rat bisphenol A increases expression ISO Faim2 (Mus musculus) 6480464 bisphenol A results in increased expression of FAIM2 mRNA CTD PMID:32156529 Faim2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of FAIM2 mRNA CTD PMID:34947998 Faim2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of FAIM2 gene CTD PMID:28505145 Faim2 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of FAIM2 mRNA CTD PMID:19167457 Faim2 Rat carbon nanotube decreases expression ISO FAIM2 (Homo sapiens) 6480464 Nanotubes and Carbon results in decreased expression of FAIM2 mRNA CTD PMID:25102311 Faim2 Rat carbon nanotube decreases expression ISO Faim2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Faim2 Rat choline multiple interactions ISO Faim2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of FAIM2 mRNA CTD PMID:20938992 Faim2 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of FAIM2 mRNA CTD PMID:16076954 Faim2 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of FAIM2 mRNA CTD PMID:26033743 Faim2 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of FAIM2 mRNA CTD PMID:26033743 Faim2 Rat cordycepin affects expression ISO FAIM2 (Homo sapiens) 6480464 cordycepin affects the expression of FAIM2 mRNA CTD PMID:28099944 Faim2 Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of FAIM2 mRNA CTD PMID:22546817 Faim2 Rat ethanol affects splicing ISO Faim2 (Mus musculus) 6480464 Ethanol affects the splicing of FAIM2 mRNA CTD PMID:30319688 Faim2 Rat ethylparaben decreases expression ISO FAIM2 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in decreased expression of FAIM2 mRNA CTD PMID:37690743 Faim2 Rat fenamidone decreases expression ISO Faim2 (Mus musculus) 6480464 fenamidone results in decreased expression of FAIM2 mRNA CTD PMID:27029645 Faim2 Rat folic acid multiple interactions ISO Faim2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of FAIM2 mRNA CTD PMID:20938992 Faim2 Rat furan decreases expression EXP 6480464 furan results in decreased expression of FAIM2 mRNA CTD PMID:25539665 Faim2 Rat graphite affects expression EXP 6480464 Graphite affects the expression of FAIM2 mRNA CTD PMID:29933104 Faim2 Rat L-methionine multiple interactions ISO Faim2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of FAIM2 mRNA CTD PMID:20938992 Faim2 Rat mono(2-ethylhexyl) phthalate decreases expression ISO Faim2 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of FAIM2 mRNA CTD PMID:22401849 Faim2 Rat monosodium L-glutamate increases expression ISO Faim2 (Mus musculus) 6480464 Sodium Glutamate results in increased expression of FAIM2 mRNA CTD PMID:19001666 Faim2 Rat N-methyl-4-phenylpyridinium increases expression ISO FAIM2 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of FAIM2 mRNA CTD PMID:24810058 Faim2 Rat N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of FAIM2 mRNA CTD PMID:28801915 Faim2 Rat N-methyl-N-nitrosourea increases expression EXP 6480464 Methylnitrosourea results in increased expression of FAIM2 mRNA CTD PMID:17412507 Faim2 Rat ozone decreases expression ISO FAIM2 (Homo sapiens) 6480464 Ozone results in decreased expression of FAIM2 mRNA CTD PMID:23033980 Faim2 Rat ozone multiple interactions ISO Faim2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of FAIM2 mRNA CTD PMID:34911549 Faim2 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of FAIM2 mRNA CTD PMID:32680482 Faim2 Rat PCB138 multiple interactions ISO Faim2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Faim2 Rat perfluorooctanoic acid increases expression ISO FAIM2 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of FAIM2 mRNA CTD PMID:23146750 Faim2 Rat potassium dichromate decreases expression ISO Faim2 (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of FAIM2 mRNA CTD PMID:23608068 Faim2 Rat rac-lactic acid decreases expression ISO FAIM2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of FAIM2 mRNA CTD PMID:30851411 Faim2 Rat resveratrol multiple interactions ISO FAIM2 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of FAIM2 mRNA CTD PMID:23557933 Faim2 Rat rofecoxib decreases expression ISO FAIM2 (Homo sapiens) 6480464 rofecoxib results in decreased expression of FAIM2 mRNA CTD PMID:17070997 Faim2 Rat sodium arsenite decreases expression ISO Faim2 (Mus musculus) 6480464 sodium arsenite results in decreased expression of FAIM2 mRNA CTD PMID:37682722 Faim2 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of FAIM2 mRNA CTD PMID:22561333 Faim2 Rat testosterone increases expression ISO Faim2 (Mus musculus) 6480464 Testosterone results in increased expression of FAIM2 mRNA CTD PMID:19693291 Faim2 Rat tunicamycin increases expression ISO FAIM2 (Homo sapiens) 6480464 Tunicamycin results in increased expression of FAIM2 mRNA CTD PMID:22378314 Faim2 Rat valproic acid increases methylation ISO FAIM2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of FAIM2 gene CTD PMID:29154799 Faim2 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of FAIM2 mRNA CTD PMID:19015723
Imported Annotations - PID (archival)
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-hydroxypropanoic acid (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) acrolein (ISO) acrylamide (ISO) afimoxifene (ISO) aflatoxin B1 (ISO) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) atrazine (EXP) beauvericin (ISO) benzo[a]pyrene (ISO) beta-carotene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) C60 fullerene (EXP) carbon nanotube (ISO) choline (ISO) cocaine (EXP) copper atom (EXP) copper(0) (EXP) cordycepin (ISO) dieldrin (EXP) ethanol (ISO) ethylparaben (ISO) fenamidone (ISO) folic acid (ISO) furan (EXP) graphite (EXP) L-methionine (ISO) mono(2-ethylhexyl) phthalate (ISO) monosodium L-glutamate (ISO) N-methyl-4-phenylpyridinium (EXP,ISO) N-methyl-N-nitrosourea (EXP) ozone (ISO) paraquat (EXP) PCB138 (ISO) perfluorooctanoic acid (ISO) potassium dichromate (ISO) rac-lactic acid (ISO) resveratrol (ISO) rofecoxib (ISO) sodium arsenite (ISO) sodium dichromate (EXP) testosterone (ISO) tunicamycin (ISO) valproic acid (ISO) vinclozolin (EXP)
Biological Process
apoptotic signaling pathway (IBA,IEA,ISO) calcium ion transmembrane transport (IEA) cerebellar granular layer development (IEA,ISO,ISS) cerebellar Purkinje cell differentiation (IEA,ISO,ISS) cerebellar Purkinje cell layer development (ISO,ISS) cerebellum development (ISO,ISS) negative regulation of apoptotic signaling pathway (ISO) negative regulation of extrinsic apoptotic signaling pathway via death domain receptors (IBA,IEA,ISO) negative regulation of neuron apoptotic process (IBA,IEA,ISO) neuron apoptotic process (IEA,ISO) regulation of neuron apoptotic process (ISO,ISS) response to ischemia (IEA,ISO)
Faim2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 132,512,095 - 132,539,192 (-) NCBI GRCr8 mRatBN7.2 7 130,632,368 - 130,659,353 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 130,633,348 - 130,659,168 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 132,436,973 - 132,462,777 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 134,662,553 - 134,688,359 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 134,575,068 - 134,600,878 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 141,158,769 - 141,185,781 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 141,157,963 - 141,185,710 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 115,663,275 - 115,689,093 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 138,246,372 - 138,272,190 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 138,322,809 - 138,348,627 (-) NCBI Celera 7 127,115,377 - 127,141,090 (-) NCBI Celera Cytogenetic Map 7 q36 NCBI
FAIM2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 49,866,896 - 49,903,900 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 49,866,896 - 49,904,217 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 50,260,679 - 50,297,683 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 48,546,947 - 48,583,987 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 48,546,946 - 48,583,987 NCBI Celera 12 49,056,734 - 49,093,776 (-) NCBI Celera Cytogenetic Map 12 q13.12 NCBI HuRef 12 47,291,842 - 47,330,172 (-) NCBI HuRef CHM1_1 12 50,227,016 - 50,263,951 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 49,829,908 - 49,867,294 (-) NCBI T2T-CHM13v2.0
Faim2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 99,394,886 - 99,432,757 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 99,394,893 - 99,426,046 (-) Ensembl GRCm39 Ensembl GRCm38 15 99,497,005 - 99,534,880 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 99,497,012 - 99,528,165 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 99,327,436 - 99,358,448 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 99,325,039 - 99,356,051 (-) NCBI MGSCv36 mm8 Celera 15 101,652,607 - 101,683,625 (-) NCBI Celera Cytogenetic Map 15 F1 NCBI cM Map 15 56.13 NCBI
Faim2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955547 466,777 - 501,490 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955547 467,331 - 501,172 (-) NCBI ChiLan1.0 ChiLan1.0
FAIM2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 44,283,833 - 44,320,109 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 44,280,595 - 44,316,871 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 38,850,588 - 38,886,614 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 39,744,705 - 39,780,702 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 39,744,700 - 39,780,702 (+) Ensembl panpan1.1 panPan2
FAIM2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 4,802,711 - 4,831,230 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 4,798,235 - 4,827,917 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 41,426,513 - 41,459,677 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 4,847,381 - 4,880,528 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 4,847,346 - 4,880,527 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 4,813,057 - 4,846,157 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 4,802,365 - 4,835,546 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 41,821,388 - 41,854,554 (-) NCBI UU_Cfam_GSD_1.0
Faim2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 65,588,905 - 65,620,783 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936512 7,544,003 - 7,576,315 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936512 7,544,047 - 7,575,922 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FAIM2
FAIM2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 46,100,437 - 46,131,046 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 46,099,895 - 46,131,155 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 199,989,447 - 200,026,442 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Faim2
.
Predicted Target Of
Count of predictions: 124 Count of miRNA genes: 90 Interacting mature miRNAs: 97 Transcripts: ENSRNOT00000048934 Prediction methods: Miranda, Pita, Rnahybrid, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1354582 Stl11 Serum triglyceride level QTL 11 3.42 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 119513385 135012528 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 1357339 Stl14 Serum triglyceride level QTL 14 3.45 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 112729683 133492707 Rat 1331748 Bp215 Blood pressure QTL 215 4.043 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 112308254 133492884 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
RH135379
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 132,512,126 - 132,512,309 (+) Marker Load Pipeline mRatBN7.2 7 130,633,264 - 130,633,447 (+) MAPPER mRatBN7.2 Rnor_6.0 7 141,159,667 - 141,159,849 NCBI Rnor6.0 Rnor_5.0 X 115,663,193 - 115,663,375 UniSTS Rnor5.0 RGSC_v3.4 7 138,246,290 - 138,246,472 UniSTS RGSC3.4 Celera 7 127,115,294 - 127,115,477 UniSTS RH 3.4 Map 7 1064.7 UniSTS Cytogenetic Map 7 q36 UniSTS
RH144326
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 130,637,976 - 130,638,192 (+) MAPPER mRatBN7.2 Rnor_6.0 7 141,164,379 - 141,164,594 NCBI Rnor6.0 Rnor_6.0 7 139,042,493 - 139,042,708 NCBI Rnor6.0 Rnor_5.0 7 138,662,899 - 138,663,114 UniSTS Rnor5.0 Rnor_5.0 X 115,667,905 - 115,668,120 UniSTS Rnor5.0 RGSC_v3.4 7 138,251,002 - 138,251,217 UniSTS RGSC3.4 Celera 7 127,120,007 - 127,120,222 UniSTS RH 3.4 Map 7 1077.3 UniSTS Cytogenetic Map 7 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
4
7
106
36
38
13
16
13
6
101
41
89
35
45
25
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000072309 ⟹ ENSRNOP00000064487
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 130,633,348 - 130,659,168 (-) Ensembl Rnor_6.0 Ensembl 7 139,047,263 - 139,063,752 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000085033 ⟹ ENSRNOP00000075485
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 7 141,157,963 - 141,185,710 (-) Ensembl
RefSeq Acc Id:
NM_144756 ⟹ NP_653357
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 132,512,209 - 132,538,026 (-) NCBI mRatBN7.2 7 130,633,347 - 130,659,168 (-) NCBI Rnor_6.0 7 141,159,749 - 141,185,567 (-) NCBI Rnor_5.0 X 115,663,275 - 115,689,093 (-) NCBI RGSC_v3.4 7 138,246,372 - 138,272,190 (-) RGD Celera 7 127,115,377 - 127,141,090 (-) RGD
Sequence:
GAGACGCAGGCAGGCTGCGGTGACCCAAGCGGCCACCCCCCGCTTCAGGGACCCCTTCCTCGAGAGACGACACCATGACCCAGGGAAAGCTCTCTGTGGCTAACAAGGCCCCTGGGACTGAGGGGCAG
hide sequence
RefSeq Acc Id:
XM_017594665 ⟹ XP_017450154
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 132,512,095 - 132,539,192 (-) NCBI mRatBN7.2 7 130,632,368 - 130,659,346 (-) NCBI Rnor_6.0 7 141,158,769 - 141,185,781 (-) NCBI
Sequence:
AATGCTCCCCGGTCTCCTGGGGTGGCTGAAGTGTGTGGGAGACGCAGAGGAGGTCAAAGCGCATGTCTTGCCCGCTCTCAGGTCCGCAGCATCCTGCGTCCGTCCGCAGCAGCATCCTCTCAGGCCCT
hide sequence
RefSeq Acc Id:
NP_653357 ⟸ NM_144756
- UniProtKB:
O88407 (UniProtKB/Swiss-Prot), A6KCF9 (UniProtKB/TrEMBL), M0R531 (UniProtKB/TrEMBL)
- Sequence:
MTQGKLSVANKAPGTEGQQQANGEKKDAPAVPSAPPSYEEATSGEGLKAGAFPQGPTAVPLHPSWAYVDPSSSSGYEGGFPAGHHELFSTFSWDDQKVRQLFIRKVYTILLVQLLVTLAVVALFTFCD
hide sequence
RefSeq Acc Id:
XP_017450154 ⟸ XM_017594665
- Peptide Label:
isoform X1
- UniProtKB:
M0R531 (UniProtKB/TrEMBL)
- Sequence:
MTQGKLSVANKAPGTEGQQQANGEKKDAPAVPSAPPSYEEATSGEGLKAGAFPQGPTAVPLHPS
hide sequence
Ensembl Acc Id:
ENSRNOP00000075485 ⟸ ENSRNOT00000085033
Ensembl Acc Id:
ENSRNOP00000064487 ⟸ ENSRNOT00000072309
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Faim2
Fas apoptotic inhibitory molecule 2
LOC102551901
protein lifeguard 2-like
Data merged from RGD:7636626
737654 PROVISIONAL
2013-12-18
LOC102551901
protein lifeguard 2-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2004-09-10
Faim2
Fas apoptotic inhibitory molecule 2
Lfg
lifeguard
Symbol and Name updated
1299863 APPROVED
2003-02-27
Lfg
lifeguard
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
expressed in brain and spinal cord
633222
gene_homology
sequence highly homologous to glutamate-binding protein (GBP)
633222
