Advanced Search (OLGA)

Gene: Nmur2 (neuromedin U receptor 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Nmur2

Name:

neuromedin U receptor 2

RGD ID:

621155

Description:

Enables neuropeptide receptor activity. Involved in regulation of sensory perception of pain. Predicted to be located in membrane. Predicted to be active in plasma membrane. Orthologous to human NMUR2 (neuromedin U receptor 2); INTERACTS WITH 17alpha-ethynylestradiol; alpha-Zearalanol; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

FM-4; G-protein coupled receptor TGR-1; G-protein-coupled receptor FM-4; neuromedin-U receptor 2; NMU-R2; Nmu2r

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NMUR2 (neuromedin U receptor 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Nmur2 (neuromedin U receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nmur2 (neuromedin U receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NMUR2 (neuromedin U receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NMUR2 (neuromedin U receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NMUR2 (neuromedin U receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NMUR2 (neuromedin U receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nmur2 (neuromedin U receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	NAGS (N-acetylglutamate synthase)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Nmur2 (neuromedin U receptor 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	NMUR2 (neuromedin U receptor 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nmur3 (neuromedin U receptor 3)	Alliance	DIOPT (OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	CapaR	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	PK1-R	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	PK2-R1	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	PK2-R2	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	nmur-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	nmur-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nmur2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	40,666,824 - 40,682,679 (-)	NCBI		GRCr8
mRatBN7.2	10	40,166,223 - 40,182,078 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	40,166,226 - 40,182,078 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	44,837,317 - 44,853,315 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	44,327,462 - 44,343,460 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	39,831,122 - 39,847,120 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	41,392,663 - 41,408,518 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	41,392,666 - 41,408,518 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	41,219,613 - 41,235,468 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	41,471,179 - 41,485,043 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	41,484,803 - 41,498,666 (-)	NCBI
Celera	10	39,485,666 - 39,501,503 (-)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nmur2	Rat	familial adenomatous polyposis 1		ISO	NMUR2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial adenomatous polyposis 1	ClinVar	PMID:17963004 more ...
Nmur2	Rat	Hereditary Neoplastic Syndromes		ISO	NMUR2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary cancer-predisposing syndrome	ClinVar	PMID:17963004 more ...

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nmur2	Rat	1,2-dichloroethane	increases expression	ISO	Nmur2 (Mus musculus)	6480464	ethylene dichloride results in increased expression of NMUR2 mRNA	CTD	PMID:28960355
Nmur2	Rat	17alpha-ethynylestradiol	increases expression	EXP		6480464	Ethinyl Estradiol results in increased expression of NMUR2 mRNA	CTD	PMID:17351261
Nmur2	Rat	2-palmitoylglycerol	increases expression	ISO	NMUR2 (Homo sapiens)	6480464	2-palmitoylglycerol results in increased expression of NMUR2 mRNA	CTD	PMID:37199045
Nmur2	Rat	acrylamide	affects methylation	ISO	Nmur2 (Mus musculus)	6480464	Acrylamide affects the methylation of NMUR2 gene	CTD	PMID:35032568
Nmur2	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of NMUR2 mRNA	CTD	PMID:35163327
Nmur2	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of NMUR2 mRNA	CTD	PMID:16483693
Nmur2	Rat	Azoxymethane	multiple interactions	ISO	Nmur2 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of NMUR2 mRNA	CTD	PMID:29950665
Nmur2	Rat	benzo[a]pyrene	increases mutagenesis	ISO	NMUR2 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased mutagenesis of NMUR2 gene	CTD	PMID:25435355
Nmur2	Rat	benzo[a]pyrene	decreases methylation	ISO	NMUR2 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of NMUR2 3' UTR and Benzo(a)pyrene results in decreased methylation of NMUR2 exon	CTD	PMID:27901495
Nmur2	Rat	benzo[a]pyrene	increases methylation	ISO	NMUR2 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of NMUR2 promoter	CTD	PMID:27901495
Nmur2	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of NMUR2 mRNA	CTD	PMID:25181051
Nmur2	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of NMUR2 mRNA	CTD	PMID:30816183 and PMID:32528016
Nmur2	Rat	carbon nanotube	increases expression	ISO	Nmur2 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
Nmur2	Rat	CGP 52608	multiple interactions	ISO	NMUR2 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to NMUR2 gene]	CTD	PMID:28238834
Nmur2	Rat	dextran sulfate	multiple interactions	ISO	Nmur2 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of NMUR2 mRNA	CTD	PMID:29950665
Nmur2	Rat	ethanol	affects expression	ISO	Nmur2 (Mus musculus)	6480464	Ethanol affects the expression of NMUR2 mRNA	CTD	PMID:26730594
Nmur2	Rat	flavonoids	increases expression	EXP		6480464	Flavonoids results in increased expression of NMUR2 mRNA	CTD	PMID:18035473
Nmur2	Rat	genistein	increases expression	ISO	Nmur2 (Mus musculus)	6480464	Genistein results in increased expression of NMUR2 mRNA	CTD	PMID:32186404
Nmur2	Rat	lead diacetate	increases expression	EXP		6480464	lead acetate results in increased expression of NMUR2 mRNA	CTD	PMID:22641619
Nmur2	Rat	N-ethyl-N-nitrosourea	increases mutagenesis	EXP		6480464	Ethylnitrosourea results in increased mutagenesis of NMUR2 gene	CTD	PMID:16495775
Nmur2	Rat	paraquat	increases expression	EXP		6480464	Paraquat results in increased expression of NMUR2 mRNA	CTD	PMID:32680482
Nmur2	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of NMUR2 mRNA	CTD	PMID:35163327
Nmur2	Rat	pirinixic acid	multiple interactions	ISO	NMUR2 (Homo sapiens)	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of NMUR2 mRNA	CTD	PMID:19710929
Nmur2	Rat	sodium arsenite	increases expression	ISO	NMUR2 (Homo sapiens)	6480464	sodium arsenite results in increased expression of NMUR2 mRNA	CTD	PMID:29301061
Nmur2	Rat	synephrine	increases activity	EXP		6480464	Synephrine results in increased activity of NMUR2 protein	CTD	PMID:24598981
Nmur2	Rat	synephrine	increases activity	ISO	NMUR2 (Homo sapiens)	6480464	Synephrine results in increased activity of NMUR2 protein	CTD	PMID:24598981
Nmur2	Rat	titanium dioxide	multiple interactions	ISO	Nmur2 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of NMUR2 mRNA	CTD	PMID:29950665
Nmur2	Rat	titanium dioxide	increases expression	ISO	Nmur2 (Mus musculus)	6480464	titanium dioxide results in increased expression of NMUR2 mRNA	CTD	PMID:35295148
Nmur2	Rat	vinclozolin	decreases expression	EXP		6480464	vinclozolin results in decreased expression of NMUR2 mRNA	CTD	PMID:23034163

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nmur2	Rat	arachidonate secretion	involved_in	ISO	NMUR2 (Homo sapiens)	1624291	PMID:10887190	RGD	PMID:10887190
Nmur2	Rat	chloride transmembrane transport	involved_in	IEA	GO:0005229	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Nmur2	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Nmur2	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR000276 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Nmur2	Rat	grooming behavior	acts_upstream_of_or_within	ISO	Nmur2 (Mus musculus)	1624291	MGI:3701426 PMID:17030627	RGD	PMID:17030627
Nmur2	Rat	neuropeptide signaling pathway	involved_in	ISO	NMUR2 (Homo sapiens)	1624291	PMID:10894543	RGD	PMID:10894543
Nmur2	Rat	neuropeptide signaling pathway	involved_in	IEA	GO:0008188	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Nmur2	Rat	neuropeptide signaling pathway	involved_in	IEA	GO:0001607	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Nmur2	Rat	neuropeptide signaling pathway	involved_in	IBA	MGI:1341898 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Nmur2	Rat	neuropeptide signaling pathway	acts_upstream_of_or_within	ISO	Nmur2 (Mus musculus)	1624291	PMID:15635449	RGD	PMID:15635449
Nmur2	Rat	phospholipase C-activating G protein-coupled receptor signaling pathway	involved_in	ISO	NMUR2 (Homo sapiens)	1624291	PMID:10899166	RGD	PMID:10899166
Nmur2	Rat	reduction of food intake in response to dietary excess	acts_upstream_of_or_within	ISO	Nmur2 (Mus musculus)	1624291	MGI:3701426 PMID:17030627	RGD	PMID:17030627
Nmur2	Rat	regulation of sensory perception of pain	involved_in	IDA		1642124	PMID:12890516	UniProt
Nmur2	Rat	response to pain	acts_upstream_of_or_within	ISO	Nmur2 (Mus musculus)	1624291	MGI:3701426 PMID:17030627	RGD	PMID:17030627
Nmur2	Rat	signal transduction	involved_in	IEA	UniProtKB-KW:KW-0807	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nmur2	Rat	membrane	located_in	ISO	NMUR2 (Homo sapiens)	1624291	PMID:10899166	RGD	PMID:10899166
Nmur2	Rat	membrane	located_in	IEA	InterPro:IPR000276 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Nmur2	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Nmur2	Rat	plasma membrane	located_in	ISO	NMUR2 (Homo sapiens)	1624291		RGD	GO_REF:0000052
Nmur2	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Nmur2	Rat	plasma membrane	is_active_in	IBA	FB:FBgn0037100 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Nmur2	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nmur2	Rat	G protein-coupled receptor activity	enables	IEA	InterPro:IPR000276	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Nmur2	Rat	G protein-coupled receptor activity	enables	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Nmur2	Rat	GTP binding	enables	ISO	NMUR2 (Homo sapiens)	1624291	PMID:10899166	RGD	PMID:10899166
Nmur2	Rat	intracellularly calcium-gated chloride channel activity	enables	ISO	NMUR2 (Homo sapiens)	1624291	PMID:10899166	RGD	PMID:10899166
Nmur2	Rat	neuromedin U binding	enables	ISO	NMUR2 (Homo sapiens)	1624291	PMID:10894543 and PMID:10899166	RGD	PMID:10894543 and PMID:10899166
Nmur2	Rat	neuromedin U receptor activity	enables	ISO	NMUR2 (Homo sapiens)	1624291	PMID:10887190 and PMID:10894543	RGD	PMID:10887190 and PMID:10894543
Nmur2	Rat	neuromedin U receptor activity	enables	IEA	InterPro:IPR005390 and InterPro:IPR005392	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Nmur2	Rat	neuropeptide receptor activity		IDA		632965		RGD
Nmur2	Rat	neuropeptide receptor activity	enables	ISO	Nmur2 (Mus musculus)	1624291	UniProtKB:P12760 more ...	RGD	PMID:15635449
Nmur2	Rat	neuropeptide receptor activity	enables	IBA	MGI:1341898 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Nmur2	Rat	neuropeptide receptor activity	enables	IEA	ARBA:ARBA00028412	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Nmur2	Rat	protein binding	enables	ISO	NMUR2 (Homo sapiens)	1624291	UniProtKB:P15884 more ...	RGD	PMID:25416956

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Identification and functional characterization of a novel subtype of neuromedin U receptor.	Hosoya M, etal., J Biol Chem 2000 Sep 22;275(38):29528-32.
3.	Identification of receptors for neuromedin U and its role in feeding.	Howard AD, etal., Nature 2000 Jul 6;406(6791):70-4.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Identification of neuromedin S and its possible role in the mammalian circadian oscillator system.	Mori K, etal., EMBO J 2005 Jan 26;24(2):325-35. Epub 2005 Jan 6.
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Pro-nociceptive effects of neuromedin U in rat.	Yu XH, etal., Neuroscience. 2003;120(2):467-74.

PMID:8889548	PMID:10899166	PMID:15631899	PMID:17030627	PMID:17110433	PMID:18180374	PMID:18698496	PMID:21296417	PMID:23423171	PMID:24269937	PMID:30227148	PMID:30914203
PMID:31069918

Nmur2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	40,666,824 - 40,682,679 (-)	NCBI		GRCr8
mRatBN7.2	10	40,166,223 - 40,182,078 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	40,166,226 - 40,182,078 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	44,837,317 - 44,853,315 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	44,327,462 - 44,343,460 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	39,831,122 - 39,847,120 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	41,392,663 - 41,408,518 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	41,392,666 - 41,408,518 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	41,219,613 - 41,235,468 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	41,471,179 - 41,485,043 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	41,484,803 - 41,498,666 (-)	NCBI
Celera	10	39,485,666 - 39,501,503 (-)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

NMUR2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	152,391,546 - 152,405,279 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	152,391,546 - 152,433,368 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	151,771,107 - 151,784,840 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	151,751,302 - 151,765,017 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	151,751,302 - 151,765,017	NCBI
Celera	5	147,846,463 - 147,860,200 (-)	NCBI		Celera
Cytogenetic Map	5	q33.1	NCBI
HuRef	5	146,910,244 - 146,923,981 (-)	NCBI		HuRef
CHM1_1	5	151,203,649 - 151,217,384 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	152,924,513 - 152,938,245 (-)	NCBI		T2T-CHM13v2.0

Nmur2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	55,915,816 - 55,931,813 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	55,915,813 - 55,931,836 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	56,024,990 - 56,040,987 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	56,024,987 - 56,041,010 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	55,838,492 - 55,854,489 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	55,868,413 - 55,884,410 (-)	NCBI		MGSCv36	mm8
Celera	11	60,806,131 - 60,822,188 (-)	NCBI		Celera
Cytogenetic Map	11	B1.3	NCBI
cM Map	11	33.39	NCBI

Nmur2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955408	6,862,243 - 6,872,805 (-)	NCBI	ChiLan1.0	ChiLan1.0

NMUR2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	147,616,118 - 147,630,526 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	145,755,664 - 145,770,047 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	147,811,260 - 147,825,659 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	153,813,004 - 153,826,791 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	153,811,055 - 153,827,176 (-)	Ensembl	panpan1.1		panPan2

NMUR2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	56,994,731 - 57,018,429 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	56,994,886 - 57,008,384 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	56,885,634 - 56,909,684 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	57,442,833 - 57,466,883 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	57,430,442 - 57,456,458 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	57,258,890 - 57,282,940 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	57,369,114 - 57,393,157 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	57,860,086 - 57,885,818 (+)	NCBI		UU_Cfam_GSD_1.0

NMUR2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	70,659,563 - 70,673,347 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	16	70,659,732 - 70,672,346 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	76,522,957 - 76,535,804 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NMUR2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	54,934,525 - 55,217,859 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	54,933,683 - 54,948,055 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	22,739,585 - 22,752,597 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nmur2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	36,597,431 - 36,611,439 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624733	36,597,310 - 36,612,589 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Nmur2
151 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	35
Count of miRNA genes:	30
Interacting mature miRNAs:	34
Transcripts:	ENSRNOT00000018967
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35392457	63642539	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	35710580	68663659	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
61332	Eau3	Experimental allergic uveoretinitis QTL 3		0.004	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	34490559	45579777	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35392267	64155584	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
1354614	Hpcl1	Hepatic cholesterol level QTL 1	3.3		liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	35392267	51793994	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	17907113	51786432	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	28875650	52200160	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat

D10Got62

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	40,173,747 - 40,173,901 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	41,400,188 - 41,400,341	NCBI	Rnor6.0
Rnor_5.0	10	41,227,138 - 41,227,291	UniSTS	Rnor5.0
RGSC_v3.4	10	41,476,712 - 41,476,866	RGD	RGSC3.4
RGSC_v3.4	10	41,476,713 - 41,476,866	UniSTS	RGSC3.4
RGSC_v3.1	10	41,490,336 - 41,490,489	RGD
Celera	10	39,493,187 - 39,493,340	UniSTS
RH 3.4 Map	10	432.5	RGD
RH 3.4 Map	10	432.5	UniSTS
Cytogenetic Map	10	q22	UniSTS

D10Got203

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	40,180,373 - 40,180,612 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	41,406,814 - 41,407,052	NCBI	Rnor6.0
Rnor_5.0	10	41,233,764 - 41,234,002	UniSTS	Rnor5.0
RGSC_v3.4	10	41,483,339 - 41,483,577	UniSTS	RGSC3.4
Celera	10	39,499,801 - 39,500,037	UniSTS
Cytogenetic Map	10	q22	UniSTS

RH144592

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	40,172,903 - 40,173,058 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	41,399,344 - 41,399,498	NCBI	Rnor6.0
Rnor_5.0	10	41,226,294 - 41,226,448	UniSTS	Rnor5.0
RGSC_v3.4	10	41,475,869 - 41,476,023	UniSTS	RGSC3.4
Celera	10	39,492,343 - 39,492,497	UniSTS
RH 3.4 Map	10	428.5	UniSTS
Cytogenetic Map	10	q22	UniSTS

AU046743

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	40,173,745 - 40,173,982 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	41,400,186 - 41,400,422	NCBI	Rnor6.0
Rnor_5.0	10	41,227,136 - 41,227,372	UniSTS	Rnor5.0
RGSC_v3.4	10	41,476,711 - 41,476,947	UniSTS	RGSC3.4
Celera	10	39,493,185 - 39,493,421	UniSTS
Cytogenetic Map	10	q22	UniSTS

BM390633

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	10	40,667,289 - 40,667,497 (+)	Marker Load Pipeline
mRatBN7.2	10	40,166,688 - 40,166,896 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	41,393,129 - 41,393,336	NCBI	Rnor6.0
Rnor_5.0	10	41,220,079 - 41,220,286	UniSTS	Rnor5.0
RGSC_v3.4	10	41,469,654 - 41,469,861	UniSTS	RGSC3.4
Celera	10	39,486,132 - 39,486,339	UniSTS
RH 3.4 Map	10	426.2	UniSTS
Cytogenetic Map	10	q22	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	1	2	71	9	25	3	7	3	1	26	9	70	4	43	22


RefSeq Transcripts	NM_022275	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269806	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB041229	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF242875	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BM384513	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB556410	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018967 ⟹ ENSRNOP00000018967

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	40,166,226 - 40,182,078 (-)	Ensembl
Rnor_6.0 Ensembl	10	41,392,666 - 41,408,518 (-)	Ensembl

RefSeq Acc Id:

NM_022275 ⟹ NP_071611

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	40,666,824 - 40,682,679 (-)	NCBI
mRatBN7.2	10	40,166,223 - 40,182,078 (-)	NCBI
Rnor_6.0	10	41,392,663 - 41,408,518 (-)	NCBI
Rnor_5.0	10	41,219,613 - 41,235,468 (-)	NCBI
RGSC_v3.4	10	41,471,179 - 41,485,043 (-)	RGD
Celera	10	39,485,666 - 39,501,503 (-)	NCBI

Sequence:

show sequence

CTGATGCTATCCTTTCACTCTCTCAGACCTTCTCCAGGAGCCTCTGCTTTCAGACTCCTTCTGGCTCAGCTTGGGACAGACACCCAGAACAAGGGACACCTGTGGTTGTGGATTTTAAGCTCAGTAAT
GGGAAAACTTGAAAATGCTTCCTGGATCCACGATCCTCTCATGAAGTACTTGAACAGCACAGAGGAGTACTTGGCCCACCTGTGTGGACCCAAGCGCAGTGACCTATCCCTTCCGGTGTCTGTGGCCT
ATGCGCTGATCTTCCTGGTGGGGGTAATGGGCAATCTTCTGGTGTGCATGGTGATTGTCCGACATCAGACTTTGAAGACACCCACCAACTACTATCTCTTCAGCTTGGCAGTCTCAGATCTGCTGGTC
CTGCTCTTGGGGATGCCTCTGGAAATCTACGAGATGTGGCACAATTACCCTTTCCTGTTCGGGCCTGTGGGATGCTACTTCAAGACAGCCCTCTTCGAGACTGTGTGCTTTGCCTCCATTCTCAGTGT
CACCACGGTTAGCGTAGAGCGCTATGTGGCCATTGTCCACCCTTTCCGAGCCAAGCTGGAGAGCACGCGGCGACGGGCCCTCAGGATCCTCAGCCTAGTCTGGAGCTTCTCTGTGGTCTTTTCTTTGC
CCAATACCAGCATCCATGGCATCAAGTTCCAGCACTTTCCCAACGGGTCCTCCGTACCTGGCTCAGCCACCTGCACAGTCACCAAACCCATGTGGGTGTATAACTTGATCATCCAAGCTACCAGCTTC
CTCTTCTACATCCTCCCAATGACCCTCATCAGCGTCCTCTACTACCTCATGGGGCTCAGGCTGAAGAGAGATGAATCCCTTGAGGCGAACAAAGTGGCTGTGAATATTCACAGACCCTCTAGAAAGTC
AGTCACCAAGATGCTGTTTGTCTTGGTCCTCGTGTTTGCCATCTGCTGGACCCCCTTCCATGTGGACCGGCTCTTCTTCAGCTTTGTGGAAGAGTGGACAGAGTCCCTGGCTGCTGTGTTCAACCTCA
TCCATGTGGTATCAGGTGTCTTCTTTTATCTGAGCTCCGCGGTCAACCCCATTATCTATAACCTCCTGTCTCGGCGCTTCCGGGCGGCCTTTCGAAATGTTGTCTCCCCTACCTGCAAATGGTGCCAT
CCCCGGCATCGGCCACAGGGACCTCCAGCCCAGAAGATCATCTTCTTGACAGAATGTCACCTCGTGGAGCTGACAGAGGATGCAGGCCCCCAGTTCCCTGGTCAGTCATCCATCCACAACACCAACCT
TACCACGGCCCCCTGTGCAGGAGAGGTACCATAAAAGGAGTGGTCAGAAGGCCTCTTCAGAAGGCCTGGATTCTGTGATTGACATCCATCTATGTGCCAAAACTGCAAGGAGGGACACCCTGTCACCT
ATGCCTCCTTGCGTGCCATTAAGAGAGGTAACAAGGCTCTTAGATTCTACGTACTCACTACTTTTTTTAATGTTAAAACTCAGACTTCGTTCTGGGCCCCAGCACAGTCCTTATACTCCATATCTCTG
TATTGTGAGTTTTCATAACTGTGATTACAGTGTGCTACGGAGTCTCACTTAACGATATTCTCATGATGGGTGGGTTTAGCCTACTAAAGGCATGGTAGAGTAGCTAAGCAGCACAGCACAGTTATCCC
AACCTCCAAACCCAGGATGCAGGAGAAACTACTGGGTGTTACTCGGACGGCTGGCTCAGAACTGCTCATAAAAGCCTAATCCTCCAATAGTTAGGGCTTTTGCAACTCTGTTGTCAAATGAGCGATGG
CTTGAAATCAGTCATGGCAGAAATATTTGTGCTACAGAAATTAACAAGCTCTGTAAATCAGAGCTAAATAATTTTTATCGCCCAGAGAGCTGGCCCACGAGCAGGTTGAGAGCTATTAATGAGCTGGC
ACTGTGCCAGCTTGCCGCGACGCGTGTGACTCGTTTTTTTCAGAACAGATGCTGGTAACGCTGCAATTATGGACTACTTAGAGTCATGGTTAACTGTGAAAAGATGCTATGGACTAGATTTAAAAATA
AAAAATAACTAGAGTTTCTACACAAAGTAGGCAAAATGCTGCTAATTAAGCCAATGGAAGCAGCATCAGCGGTTTATAATTAACCTAGAGAAGAAGGGTTATTTTTGGATGCCATCCATTAACATTAA
TGCAGAAAACAACAATGGACCGGGTGTTGTTTCCCCTCACACGTCTGTATTTGCAGAGCCCACAGGATATGTTGTCAAAACAGATGACTTTTCTATAGTCATCTCCACTTGGCTGCAGATTTATTTCC
TTCTTAACGGGTAGAAACTCAGCCTAGGACTGGAGGGACGACGCAACGGACAAAGGCACCCGCCACCAAGCCTGAGGATCTGAATTCCATACCCGGAACACACATGGTGGAAGGAGAGAGAACTGACT
TCCTCAAGTTGTCCTTGGACCTCCAAACATGCACCATGGCAATATGCCCTCCCCCACCCCAACACTTGCCACACTGGATAAGTTAATATAAAAAAAAATAAAGAAGTATATTGTTAATCCATAGTGTG
GAAGCTAACAGGTATACTGTCTTCTAGAAGCCTAGAAAACCAGTGGTTGCCTGAATGCTCCATGGAGTCTGCTTCTGTCACTCAACCTGTGCCACTGTAGAAGCTCTTTCAAGGCAATGTCAGTAATT
GAAAGTTTTGACTAATTTATGTATGGGACCCATATTGTAGAATCTACCTACATTATATACCAGGATATCACTGCTAGTGAAATATGTTCATTACACAAAACAGACTATTAACTTAGAGACTTAGAAAG
ATGGACAAGTCAGGCAAAGAAAGTCAAAGTCCAGGACAAAGAGAAGCAAAGCTGGAGAGACAAGAAATGTCTCATGGGCAAAGGCATTTGTGCATAAGCCTGCTGGTCCAAGTTTTTTGGTTAAGGAA
GAGATCCAATGCCTGAAATTGTTCTCTGACCTCCATAGTCACCATGGTTTGTGTCAAAAAACCTCCTCACACGTAATAATGAAAGAATTGCTTTAAAGAAAAGCAATTTACCCTTTCAAACTCATTCA
CTGCTATGAAACCACATGGACACATAGATAAGAAATTCTGTGAGTTAGTAGTCATTTTGAAGATAGATCTTAAAAGGCTTCATAGAACATGCTTATTTGTATATTTCCACAGCATAAAGACTATCTTT
TACGAACACTTTCTGCTCTGTTTTATAAATGCTGAAAATTTCAGGTCCTGATTTTGACCACCCGTTCCTCAGTATTGAAATGGAATAAAGGTTGCCCTGTCCACAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063269806 ⟹ XP_063125876

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	40,666,824 - 40,682,673 (-)	NCBI


Protein RefSeqs	NP_071611	(Get FASTA)	NCBI Sequence Viewer
	XP_063125876	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF82756	(Get FASTA)	NCBI Sequence Viewer
	BAB13722	(Get FASTA)	NCBI Sequence Viewer
	EDM04491	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018967
	ENSRNOP00000018967.2
GenBank Protein	Q9ESQ4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_071611 ⟸ NM_022275

- UniProtKB:

Q9JIB1 (UniProtKB/Swiss-Prot), Q9ESQ4 (UniProtKB/Swiss-Prot), A0A8L2QAH3 (UniProtKB/TrEMBL), A6HEN6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGKLENASWIHDPLMKYLNSTEEYLAHLCGPKRSDLSLPVSVAYALIFLVGVMGNLLVCMVIVRHQTLKTPTNYYLFSLAVSDLLVLLLGMPLEIYEMWHNYPFLFGPVGCYFKTALFETVCFASILS
VTTVSVERYVAIVHPFRAKLESTRRRALRILSLVWSFSVVFSLPNTSIHGIKFQHFPNGSSVPGSATCTVTKPMWVYNLIIQATSFLFYILPMTLISVLYYLMGLRLKRDESLEANKVAVNIHRPSRK
SVTKMLFVLVLVFAICWTPFHVDRLFFSFVEEWTESLAAVFNLIHVVSGVFFYLSSAVNPIIYNLLSRRFRAAFRNVVSPTCKWCHPRHRPQGPPAQKIIFLTECHLVELTEDAGPQFPGQSSIHNTN
LTTAPCAGEVP

hide sequence

Ensembl Acc Id:

ENSRNOP00000018967 ⟸ ENSRNOT00000018967

RefSeq Acc Id:	XP_063125876 ⟸ XM_063269806
- Peptide Label:	isoform X1
- UniProtKB:	Q9JIB1 (UniProtKB/Swiss-Prot), Q9ESQ4 (UniProtKB/Swiss-Prot), A0A8L2QAH3 (UniProtKB/TrEMBL), A6HEN6 (UniProtKB/TrEMBL)

Protein Domains

G-protein coupled receptors family 1 profile

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9ESQ4-F1-model_v2	AlphaFold	Q9ESQ4	1-395	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-25069	BioCyc
Ensembl Genes	ENSRNOG00000014081	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000018967	ENTREZGENE
	ENSRNOT00000018967.4	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NeuromedU_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NeuromedU_rcpt_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NMU-R2_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:64042	UniProtKB/Swiss-Prot
NCBI Gene	64042	ENTREZGENE
PANTHER	G-PROTEIN COUPLED RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NEUROMEDIN-U RECEPTOR 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NmU-R2_C_term	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Nmur2	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NEUROMEDINUR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NEUROMEDNU2R	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000014081	RatGTEx
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8L2QAH3	ENTREZGENE, UniProtKB/TrEMBL
	A6HEN6	ENTREZGENE, UniProtKB/TrEMBL
	NMUR2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q9JIB1	ENTREZGENE
UniProt Secondary	Q9JIB1	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Description	Reference	Status
2004-09-10	Nmur2	neuromedin U receptor 2	Nmu2r	Symbol updated	1299863	APPROVED
2004-02-26	Nmu2r	neuromedin U receptor 2		Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Nmu2r	neuromedin U receptor 2		Symbol and Name status set to provisional	70820	PROVISIONAL

Note Type	Note	Reference
gene_expression	expressed in the ventromedial hypothalamus	632965

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar