Symbol:
Slc16a3
Name:
solute carrier family 16 member 3
RGD ID:
620603
Description:
Enables lactate:proton symporter activity. Involved in plasma membrane lactate transport. Located in plasma membrane. Orthologous to human SLC16A3 (solute carrier family 16 member 3); INTERACTS WITH 17alpha-ethynylestradiol; 2,4-D; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MCT 3; MCT 4; Mct3; MCT4; monocarboxylate transporter; monocarboxylate transporter 3; monocarboxylate transporter 4; solute carrier family 16 (monocarboxylate transporter), member 3; solute carrier family 16 (monocarboxylic acid transporters), member 3; solute carrier family 16, member 3 (monocarboxylic acid transporter 4)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SLC16A3 (solute carrier family 16 member 3) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Slc16a3 (solute carrier family 16 (monocarboxylic acid transporters), member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Slc16a3 (solute carrier family 16 member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SLC16A3 (solute carrier family 16 member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SLC16A3 (solute carrier family 16 member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Slc16a3 (solute carrier family 16 member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SLC16A3 (solute carrier family 16 member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SLC16A3 (solute carrier family 16 member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Slc16a3 (solute carrier family 16 member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
IFT57 (intraflagellar transport 57) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
SLC16A3 (solute carrier family 16 member 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Slc16a3 (solute carrier family 16 (monocarboxylic acid transporters), member 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
si:ch211-234h8.7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
slc16a3 (solute carrier family 16 member 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG11665
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
CG14196
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
MCH4
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Mct1
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|SonicParanoid)
Caenorhabditis elegans (roundworm):
mct-6
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG8028
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
CG8034
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
CG8051
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
out
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
slc16a3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 106,712,328 - 106,756,168 (+) NCBI GRCr8 mRatBN7.2 10 106,212,679 - 106,222,564 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 106,212,778 - 106,222,562 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 111,318,174 - 111,326,740 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 110,781,213 - 110,789,779 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 106,134,447 - 106,143,022 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 110,138,519 - 110,148,360 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 110,138,586 - 110,148,358 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 109,726,073 - 109,735,892 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 110,159,679 - 110,163,182 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 110,174,182 - 110,177,686 (+) NCBI Celera 10 104,753,007 - 104,761,582 (+) NCBI Celera Cytogenetic Map 10 q32.3 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Slc16a3 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of SLC16A3 mRNA CTD PMID:22079256 Slc16a3 Rat 1,2-dimethylhydrazine increases expression ISO Slc16a3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of SLC16A3 mRNA CTD PMID:22206623 Slc16a3 Rat 17alpha-ethynylestradiol multiple interactions ISO Slc16a3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SLC16A3 mRNA CTD PMID:17942748 Slc16a3 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of SLC16A3 mRNA CTD PMID:17557909 Slc16a3 Rat 17beta-estradiol decreases expression ISO SLC16A3 (Homo sapiens) 6480464 Estradiol results in decreased expression of SLC16A3 mRNA CTD PMID:21632981 Slc16a3 Rat 17beta-estradiol increases expression ISO SLC16A3 (Homo sapiens) 6480464 Estradiol results in increased expression of SLC16A3 mRNA CTD PMID:23019147 Slc16a3 Rat 17beta-estradiol multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 [Estradiol binds to ESR2 protein] which results in increased expression of SLC16A3 mRNA CTD PMID:20404318 Slc16a3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Slc16a3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SLC16A3 mRNA CTD PMID:17942748 Slc16a3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Slc16a3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SLC16A3 mRNA CTD PMID:19770486 and PMID:19933214 Slc16a3 Rat 2,4-D decreases expression EXP 6480464 2 and 4-Dichlorophenoxyacetic Acid results in decreased expression of SLC16A3 mRNA CTD PMID:23538319 Slc16a3 Rat 2,4-D increases expression EXP 6480464 2 and 4-Dichlorophenoxyacetic Acid results in increased expression of SLC16A3 mRNA CTD PMID:23538319 Slc16a3 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO SLC16A3 (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Slc16a3 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Slc16a3 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Slc16a3 Rat 2,6-dimethoxyphenol multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Slc16a3 Rat 2-hydroxypropanoic acid multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 SLC16A3 protein affects the reaction [Lactic Acid results in decreased expression of SEMA3A protein] more ... CTD PMID:37611839 Slc16a3 Rat 3,3',5-triiodo-L-thyronine increases expression ISO SLC16A3 (Homo sapiens) 6480464 Triiodothyronine results in increased expression of SLC16A3 mRNA CTD PMID:15507505 Slc16a3 Rat 4,4'-sulfonyldiphenol decreases expression ISO SLC16A3 (Homo sapiens) 6480464 bisphenol S results in decreased expression of SLC16A3 mRNA CTD PMID:27685785 Slc16a3 Rat 5-aza-2'-deoxycytidine affects expression ISO SLC16A3 (Homo sapiens) 6480464 Decitabine affects the expression of SLC16A3 mRNA CTD PMID:23300844 Slc16a3 Rat 5-aza-2'-deoxycytidine increases expression ISO SLC16A3 (Homo sapiens) 6480464 Decitabine results in increased expression of SLC16A3 mRNA CTD PMID:19194470 Slc16a3 Rat 5-methyl-4-oxido-2-pyrazin-4-iumcarboxylic acid increases expression ISO SLC16A3 (Homo sapiens) 6480464 acipimox results in increased expression of SLC16A3 mRNA CTD PMID:25352640 Slc16a3 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SLC16A3 mRNA CTD PMID:24780913 and PMID:30047161 Slc16a3 Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:19480007 Slc16a3 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of SLC16A3 mRNA CTD PMID:31881176 Slc16a3 Rat acrolein multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of SLC16A3 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of SLC16A3 mRNA CTD PMID:32699268 Slc16a3 Rat acrylamide decreases expression ISO SLC16A3 (Homo sapiens) 6480464 Acrylamide results in decreased expression of SLC16A3 mRNA CTD PMID:32763439 Slc16a3 Rat all-trans-retinoic acid increases expression ISO SLC16A3 (Homo sapiens) 6480464 Tretinoin results in increased expression of SLC16A3 mRNA CTD PMID:15498508 Slc16a3 Rat all-trans-retinoic acid multiple interactions ISO Slc16a3 (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in increased expression of SLC16A3 mRNA CTD PMID:30951980 Slc16a3 Rat all-trans-retinoic acid multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 [Tretinoin co-treated with arsenic trioxide] results in increased expression of SLC16A3 mRNA CTD PMID:15894607 Slc16a3 Rat alpha-pinene multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of SLC16A3 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of SLC16A3 mRNA CTD PMID:32699268 Slc16a3 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of SLC16A3 mRNA CTD PMID:35163327 Slc16a3 Rat alpha-Zearalanol decreases expression EXP 6480464 Zeranol results in decreased expression of SLC16A3 mRNA CTD PMID:35163327 Slc16a3 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of SLC16A3 mRNA CTD PMID:30047161 Slc16a3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SLC16A3 mRNA CTD PMID:16483693 Slc16a3 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of SLC16A3 mRNA CTD PMID:30779732 Slc16a3 Rat antirheumatic drug decreases expression ISO SLC16A3 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of SLC16A3 mRNA CTD PMID:24449571 Slc16a3 Rat arsane increases ubiquitination ISO SLC16A3 (Homo sapiens) 6480464 Arsenic results in increased ubiquitination of SLC16A3 protein CTD PMID:35994080 Slc16a3 Rat arsenic atom increases ubiquitination ISO SLC16A3 (Homo sapiens) 6480464 Arsenic results in increased ubiquitination of SLC16A3 protein CTD PMID:35994080 Slc16a3 Rat arsenite(3-) multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to SLC16A3 protein] CTD PMID:32406909 Slc16a3 Rat arsenous acid multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 [Tretinoin co-treated with Arsenic Trioxide] results in increased expression of SLC16A3 mRNA CTD PMID:15894607 Slc16a3 Rat atrazine increases expression ISO SLC16A3 (Homo sapiens) 6480464 Atrazine results in increased expression of SLC16A3 mRNA CTD PMID:22378314 Slc16a3 Rat Azoxymethane multiple interactions ISO Slc16a3 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SLC16A3 mRNA CTD PMID:29950665 Slc16a3 Rat benzene increases expression ISO SLC16A3 (Homo sapiens) 6480464 Benzene results in increased expression of SLC16A3 mRNA CTD PMID:19162166 Slc16a3 Rat benzo[a]pyrene decreases expression ISO SLC16A3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of SLC16A3 mRNA CTD PMID:20106945 Slc16a3 Rat benzo[a]pyrene increases methylation ISO SLC16A3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of SLC16A3 3' UTR and Benzo(a)pyrene results in increased methylation of SLC16A3 exon CTD PMID:27901495 Slc16a3 Rat benzo[a]pyrene affects methylation ISO SLC16A3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SLC16A3 5' UTR and Benzo(a)pyrene affects the methylation of SLC16A3 promoter CTD PMID:27901495 Slc16a3 Rat beta-lapachone decreases expression ISO SLC16A3 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of SLC16A3 mRNA CTD PMID:38218311 Slc16a3 Rat beta-lapachone increases expression ISO SLC16A3 (Homo sapiens) 6480464 beta-lapachone results in increased expression of SLC16A3 mRNA CTD PMID:38218311 Slc16a3 Rat bis(2-ethylhexyl) phthalate increases expression ISO SLC16A3 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of SLC16A3 mRNA CTD PMID:31163220 Slc16a3 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Slc16a3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLC16A3 mRNA CTD PMID:39150890 Slc16a3 Rat bisphenol A increases expression ISO SLC16A3 (Homo sapiens) 6480464 bisphenol A results in increased expression of SLC16A3 mRNA and bisphenol A results in increased expression of SLC16A3 protein CTD PMID:23019147 and PMID:37567409 Slc16a3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SLC16A3 mRNA CTD PMID:34947998 Slc16a3 Rat bisphenol A multiple interactions ISO Slc16a3 (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in increased expression of SLC16A3 mRNA CTD PMID:30951980 Slc16a3 Rat bisphenol A affects expression ISO SLC16A3 (Homo sapiens) 6480464 bisphenol A affects the expression of SLC16A3 mRNA CTD PMID:30903817 Slc16a3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SLC16A3 mRNA CTD PMID:25181051 Slc16a3 Rat bisphenol F multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of SLC16A3 gene CTD PMID:31601247 Slc16a3 Rat bruceine D multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 bruceine D affects the reaction [Oxygen deficiency affects the expression of SLC16A3 protein] and CTNNBIP1 protein affects the reaction [bruceine D affects the reaction [Oxygen deficiency affects the expression of SLC16A3 protein]] CTD PMID:34900531 Slc16a3 Rat Butylbenzyl phthalate multiple interactions ISO Slc16a3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLC16A3 mRNA CTD PMID:39150890 Slc16a3 Rat cadmium atom multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of SLC16A3 mRNA CTD PMID:35301059 Slc16a3 Rat cadmium dichloride affects expression ISO Slc16a3 (Mus musculus) 6480464 Cadmium Chloride affects the expression of SLC16A3 mRNA CTD PMID:30615929 Slc16a3 Rat cadmium dichloride multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of SLC16A3 mRNA CTD PMID:35301059 Slc16a3 Rat cadmium dichloride multiple interactions ISO Slc16a3 (Mus musculus) 6480464 Cadmium Chloride affects the expression of and affects the localization of SLC16A3 protein CTD PMID:30615929 Slc16a3 Rat captan increases expression ISO Slc16a3 (Mus musculus) 6480464 Captan results in increased expression of SLC16A3 mRNA CTD PMID:31558096 Slc16a3 Rat carbon nanotube increases expression ISO Slc16a3 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Slc16a3 Rat celecoxib multiple interactions ISO Slc16a3 (Mus musculus) 6480464 Celecoxib inhibits the reaction [Nickel results in increased expression of SLC16A3 mRNA] CTD PMID:27452194 Slc16a3 Rat CGP 52608 multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SLC16A3 gene] CTD PMID:28238834 Slc16a3 Rat chlordecone increases expression ISO Slc16a3 (Mus musculus) 6480464 Chlordecone results in increased expression of SLC16A3 mRNA CTD PMID:33711761 Slc16a3 Rat chloropicrin decreases expression ISO SLC16A3 (Homo sapiens) 6480464 chloropicrin results in decreased expression of SLC16A3 mRNA CTD PMID:26352163 Slc16a3 Rat chlorpyrifos increases expression ISO Slc16a3 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of SLC16A3 mRNA CTD PMID:37019170 Slc16a3 Rat choline multiple interactions ISO Slc16a3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of SLC16A3 gene CTD PMID:20938992 Slc16a3 Rat cisplatin affects expression ISO SLC16A3 (Homo sapiens) 6480464 Cisplatin affects the expression of SLC16A3 mRNA CTD PMID:23300844 Slc16a3 Rat cobalt dichloride multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 zinc chloride inhibits the reaction [cobaltous chloride results in increased expression of SLC16A3 mRNA] CTD PMID:22202117 Slc16a3 Rat cobalt dichloride increases expression ISO SLC16A3 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of SLC16A3 mRNA CTD PMID:22202117 and PMID:24356939 Slc16a3 Rat cocaine decreases expression EXP 6480464 Cocaine results in decreased expression of SLC16A3 mRNA CTD PMID:17898221 Slc16a3 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of SLC16A3 mRNA CTD PMID:26033743 Slc16a3 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of SLC16A3 mRNA CTD PMID:26033743 Slc16a3 Rat copper(II) sulfate decreases expression ISO SLC16A3 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of SLC16A3 mRNA CTD PMID:19549813 Slc16a3 Rat corilagin multiple interactions EXP 6480464 corilagin inhibits the reaction [Methylnitronitrosoguanidine results in increased expression of SLC16A3 mRNA] CTD PMID:35103375 Slc16a3 Rat coumarin decreases phosphorylation ISO SLC16A3 (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of SLC16A3 protein CTD PMID:35688186 Slc16a3 Rat cyclosporin A increases expression ISO SLC16A3 (Homo sapiens) 6480464 Cyclosporine results in increased expression of SLC16A3 mRNA CTD PMID:20106945 Slc16a3 Rat cyclosporin A decreases methylation ISO SLC16A3 (Homo sapiens) 6480464 Cyclosporine results in decreased methylation of SLC16A3 promoter CTD PMID:27989131 Slc16a3 Rat cypermethrin decreases expression ISO Slc16a3 (Mus musculus) 6480464 cypermethrin results in decreased expression of SLC16A3 protein CTD PMID:38582279 Slc16a3 Rat cytarabine decreases expression ISO SLC16A3 (Homo sapiens) 6480464 Cytarabine results in decreased expression of SLC16A3 mRNA CTD PMID:21198554 Slc16a3 Rat dexamethasone multiple interactions ISO Slc16a3 (Mus musculus) 6480464 Dexamethasone inhibits the reaction [Nickel results in increased expression of SLC16A3 mRNA] CTD PMID:27452194 Slc16a3 Rat dextran sulfate multiple interactions ISO Slc16a3 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SLC16A3 mRNA CTD PMID:29950665 Slc16a3 Rat diarsenic trioxide multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 [Tretinoin co-treated with Arsenic Trioxide] results in increased expression of SLC16A3 mRNA CTD PMID:15894607 Slc16a3 Rat Dibutyl phosphate affects expression ISO SLC16A3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SLC16A3 mRNA CTD PMID:37042841 Slc16a3 Rat dibutyl phthalate multiple interactions ISO Slc16a3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLC16A3 mRNA CTD PMID:39150890 Slc16a3 Rat dibutyl phthalate increases expression ISO Slc16a3 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of SLC16A3 protein CTD PMID:36736749 Slc16a3 Rat diethyl phthalate multiple interactions ISO Slc16a3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLC16A3 mRNA CTD PMID:39150890 Slc16a3 Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of SLC16A3 mRNA CTD PMID:21658437 Slc16a3 Rat diisobutyl phthalate multiple interactions ISO Slc16a3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLC16A3 mRNA CTD PMID:39150890 Slc16a3 Rat diisononyl phthalate multiple interactions ISO Slc16a3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLC16A3 mRNA CTD PMID:39150890 Slc16a3 Rat dinophysistoxin 1 increases expression ISO SLC16A3 (Homo sapiens) 6480464 dinophysistoxin 1 results in increased expression of SLC16A3 mRNA CTD PMID:28939011 Slc16a3 Rat dioxygen increases expression ISO Slc16a3 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of SLC16A3 mRNA CTD PMID:20880076 and PMID:23437309 Slc16a3 Rat dioxygen multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 bruceine D affects the reaction [Oxygen deficiency affects the expression of SLC16A3 protein] and CTNNBIP1 protein affects the reaction [bruceine D affects the reaction [Oxygen deficiency affects the expression of SLC16A3 protein]] CTD PMID:34900531 Slc16a3 Rat dioxygen affects expression ISO SLC16A3 (Homo sapiens) 6480464 Oxygen deficiency affects the expression of SLC16A3 protein CTD PMID:34900531 Slc16a3 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of SLC16A3 mRNA CTD PMID:33729688 Slc16a3 Rat dioxygen increases expression ISO SLC16A3 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of SLC16A3 mRNA CTD PMID:17175027 more ... Slc16a3 Rat dorsomorphin multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Slc16a3 Rat doxorubicin affects expression ISO SLC16A3 (Homo sapiens) 6480464 Doxorubicin affects the expression of SLC16A3 mRNA CTD PMID:29803840 Slc16a3 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of SLC16A3 mRNA CTD PMID:29391264 Slc16a3 Rat entinostat increases expression ISO SLC16A3 (Homo sapiens) 6480464 entinostat results in increased expression of SLC16A3 mRNA CTD PMID:27188386 Slc16a3 Rat folic acid multiple interactions ISO Slc16a3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of SLC16A3 gene CTD PMID:20938992 Slc16a3 Rat folpet increases expression ISO Slc16a3 (Mus musculus) 6480464 folpet results in increased expression of SLC16A3 mRNA CTD PMID:31558096 Slc16a3 Rat FR900359 increases phosphorylation ISO SLC16A3 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of SLC16A3 protein CTD PMID:37730182 Slc16a3 Rat fulvestrant multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of SLC16A3 gene CTD PMID:31601247 Slc16a3 Rat furfural multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Slc16a3 Rat genistein increases expression ISO SLC16A3 (Homo sapiens) 6480464 Genistein results in increased expression of SLC16A3 mRNA CTD PMID:23019147 Slc16a3 Rat glycidol increases expression EXP 6480464 glycidol results in increased expression of SLC16A3 mRNA CTD PMID:24915197 Slc16a3 Rat GW 4064 decreases expression ISO Slc16a3 (Mus musculus) 6480464 GW 4064 results in decreased expression of SLC16A3 mRNA CTD PMID:26655953 Slc16a3 Rat hydrogen peroxide affects expression ISO SLC16A3 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of SLC16A3 mRNA CTD PMID:20044591 Slc16a3 Rat indometacin multiple interactions ISO Slc16a3 (Mus musculus) 6480464 Indomethacin inhibits the reaction [Nickel results in increased expression of SLC16A3 mRNA] CTD PMID:27452194 Slc16a3 Rat ivermectin decreases expression ISO SLC16A3 (Homo sapiens) 6480464 Ivermectin results in decreased expression of SLC16A3 protein CTD PMID:32959892 Slc16a3 Rat L-methionine multiple interactions ISO Slc16a3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of SLC16A3 gene CTD PMID:20938992 Slc16a3 Rat lanthanum trichloride decreases expression EXP 6480464 lanthanum chloride results in decreased expression of SLC16A3 mRNA and lanthanum chloride results in decreased expression of SLC16A3 protein CTD PMID:29264619 Slc16a3 Rat lead diacetate multiple interactions ISO Slc16a3 (Mus musculus) 6480464 [lead acetate results in increased abundance of Lead] which results in increased expression of SLC16A3 protein more ... CTD PMID:30615929 and PMID:34508822 Slc16a3 Rat lead diacetate increases expression ISO Slc16a3 (Mus musculus) 6480464 lead acetate results in increased expression of SLC16A3 mRNA CTD PMID:30615929 Slc16a3 Rat lead(0) multiple interactions ISO Slc16a3 (Mus musculus) 6480464 [lead acetate results in increased abundance of Lead] which results in increased expression of SLC16A3 protein and [Zinc Acetate results in increased abundance of Zinc] inhibits the reaction [[lead acetate results in increased abundance of Lead] which results in increased expression of SLC16A3 protein] CTD PMID:34508822 Slc16a3 Rat manganese atom increases expression ISO SLC16A3 (Homo sapiens) 6480464 Manganese results in increased expression of SLC16A3 mRNA CTD PMID:17175027 Slc16a3 Rat manganese(0) increases expression ISO SLC16A3 (Homo sapiens) 6480464 Manganese results in increased expression of SLC16A3 mRNA CTD PMID:17175027 Slc16a3 Rat manganese(II) chloride increases expression ISO SLC16A3 (Homo sapiens) 6480464 manganese chloride results in increased expression of SLC16A3 mRNA CTD PMID:17175027 Slc16a3 Rat menadione affects expression ISO SLC16A3 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of SLC16A3 mRNA CTD PMID:20044591 Slc16a3 Rat mercury dibromide decreases expression ISO SLC16A3 (Homo sapiens) 6480464 mercuric bromide results in decreased expression of SLC16A3 mRNA CTD PMID:26272509 Slc16a3 Rat mercury dibromide multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SLC16A3 mRNA CTD PMID:27188386 Slc16a3 Rat methylmercury chloride decreases expression ISO SLC16A3 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of SLC16A3 mRNA CTD PMID:23179753 and PMID:27188386 Slc16a3 Rat Monobutylphthalate increases expression ISO Slc16a3 (Mus musculus) 6480464 monobutyl phthalate results in increased expression of SLC16A3 protein CTD PMID:36736749 Slc16a3 Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of SLC16A3 mRNA CTD PMID:16026605 and PMID:28801915 Slc16a3 Rat N-methyl-4-phenylpyridinium increases expression ISO SLC16A3 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of SLC16A3 mRNA CTD PMID:24810058 Slc16a3 Rat N-methyl-4-phenylpyridinium decreases expression ISO Slc16a3 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of SLC16A3 mRNA CTD PMID:17475336 Slc16a3 Rat N-methyl-N'-nitro-N-nitrosoguanidine increases expression EXP 6480464 Methylnitronitrosoguanidine results in increased expression of SLC16A3 mRNA CTD PMID:35103375 Slc16a3 Rat N-methyl-N'-nitro-N-nitrosoguanidine multiple interactions EXP 6480464 corilagin inhibits the reaction [Methylnitronitrosoguanidine results in increased expression of SLC16A3 mRNA] CTD PMID:35103375 Slc16a3 Rat N-Nitrosopyrrolidine increases expression ISO SLC16A3 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in increased expression of SLC16A3 mRNA CTD PMID:32234424 Slc16a3 Rat naphthalenes increases expression EXP 6480464 Naphthalenes results in increased expression of SLC16A3 protein CTD PMID:17337753 Slc16a3 Rat nickel atom increases expression ISO SLC16A3 (Homo sapiens) 6480464 Nickel results in increased expression of SLC16A3 mRNA CTD PMID:24768652 and PMID:25583101 Slc16a3 Rat nickel atom increases expression ISO Slc16a3 (Mus musculus) 6480464 Nickel results in increased expression of SLC16A3 mRNA CTD PMID:27452194 Slc16a3 Rat nickel atom multiple interactions ISO Slc16a3 (Mus musculus) 6480464 Celecoxib inhibits the reaction [Nickel results in increased expression of SLC16A3 mRNA] more ... CTD PMID:27452194 Slc16a3 Rat nickel dichloride multiple interactions ISO Slc16a3 (Mus musculus) 6480464 Dinoprostone promotes the reaction [nickel chloride results in increased expression of SLC16A3 mRNA] CTD PMID:27452194 Slc16a3 Rat nickel dichloride increases expression ISO Slc16a3 (Mus musculus) 6480464 nickel chloride results in increased expression of SLC16A3 mRNA CTD PMID:27452194 Slc16a3 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of SLC16A3 protein CTD PMID:26996590 Slc16a3 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of SLC16A3 mRNA CTD PMID:25729387 Slc16a3 Rat ozone multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of SLC16A3 mRNA more ... CTD PMID:32699268 and PMID:35430440 Slc16a3 Rat paracetamol decreases expression ISO SLC16A3 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of SLC16A3 mRNA CTD PMID:29067470 Slc16a3 Rat paracetamol affects expression ISO Slc16a3 (Mus musculus) 6480464 Acetaminophen affects the expression of SLC16A3 mRNA and Acetaminophen affects the expression of SLC16A3 protein CTD PMID:17562736 and PMID:39032760 Slc16a3 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of SLC16A3 mRNA CTD PMID:32680482 Slc16a3 Rat perfluorohexanesulfonic acid decreases expression ISO Slc16a3 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of SLC16A3 mRNA CTD PMID:37995155 Slc16a3 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of SLC16A3 mRNA CTD PMID:35163327 Slc16a3 Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of SLC16A3 mRNA CTD PMID:18158353 Slc16a3 Rat potassium chromate decreases expression ISO SLC16A3 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of SLC16A3 mRNA CTD PMID:22079256 Slc16a3 Rat potassium chromate multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of SLC16A3 mRNA CTD PMID:22079256 Slc16a3 Rat prostaglandin E2 multiple interactions ISO Slc16a3 (Mus musculus) 6480464 Dinoprostone promotes the reaction [nickel chloride results in increased expression of SLC16A3 mRNA] CTD PMID:27452194 Slc16a3 Rat quercetin affects expression EXP 6480464 Quercetin affects the expression of SLC16A3 mRNA CTD PMID:18178720 Slc16a3 Rat quercetin increases expression ISO SLC16A3 (Homo sapiens) 6480464 Quercetin results in increased expression of SLC16A3 mRNA CTD PMID:21632981 Slc16a3 Rat rac-lactic acid multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 SLC16A3 protein affects the reaction [Lactic Acid results in decreased expression of SEMA3A protein] more ... CTD PMID:37611839 Slc16a3 Rat SB 431542 multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Slc16a3 Rat serpentine asbestos increases expression ISO SLC16A3 (Homo sapiens) 6480464 Asbestos and Serpentine results in increased expression of SLC16A3 mRNA CTD PMID:29523930 Slc16a3 Rat silicon dioxide decreases expression ISO SLC16A3 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of SLC16A3 mRNA CTD PMID:25895662 Slc16a3 Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of SLC16A3 mRNA CTD PMID:22431001 Slc16a3 Rat sodium arsenite affects methylation ISO SLC16A3 (Homo sapiens) 6480464 sodium arsenite affects the methylation of SLC16A3 gene CTD PMID:28589171 Slc16a3 Rat sodium arsenite decreases expression ISO SLC16A3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of SLC16A3 mRNA CTD PMID:38568856 Slc16a3 Rat sodium chloride multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of SLC16A3 protein more ... CTD PMID:38598786 Slc16a3 Rat sodium dichromate increases expression ISO Slc16a3 (Mus musculus) 6480464 sodium bichromate results in increased expression of SLC16A3 mRNA CTD PMID:31558096 Slc16a3 Rat Soman increases expression EXP 6480464 Soman results in increased expression of SLC16A3 mRNA CTD PMID:19281266 Slc16a3 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of SLC16A3 mRNA CTD PMID:30047161 Slc16a3 Rat tamibarotene increases expression ISO SLC16A3 (Homo sapiens) 6480464 tamibarotene results in increased expression of SLC16A3 mRNA CTD PMID:15498508 Slc16a3 Rat temozolomide increases expression ISO SLC16A3 (Homo sapiens) 6480464 Temozolomide results in increased expression of SLC16A3 mRNA CTD PMID:31758290 Slc16a3 Rat tetrachloromethane affects expression ISO Slc16a3 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of SLC16A3 mRNA CTD PMID:17484886 Slc16a3 Rat thiram decreases expression ISO SLC16A3 (Homo sapiens) 6480464 Thiram results in decreased expression of SLC16A3 mRNA CTD PMID:38568856 Slc16a3 Rat titanium dioxide affects expression ISO Slc16a3 (Mus musculus) 6480464 titanium dioxide affects the expression of SLC16A3 mRNA CTD PMID:23557971 Slc16a3 Rat titanium dioxide decreases methylation ISO Slc16a3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SLC16A3 gene CTD PMID:35295148 Slc16a3 Rat titanium dioxide increases methylation ISO Slc16a3 (Mus musculus) 6480464 titanium dioxide results in increased methylation of SLC16A3 gene CTD PMID:35295148 Slc16a3 Rat titanium dioxide multiple interactions ISO Slc16a3 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SLC16A3 mRNA CTD PMID:29950665 Slc16a3 Rat titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of SLC16A3 mRNA CTD PMID:30012374 Slc16a3 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of SLC16A3 mRNA CTD PMID:25729387 Slc16a3 Rat tributylstannane increases expression EXP 6480464 tributyltin results in increased expression of SLC16A3 mRNA and tributyltin results in increased expression of SLC16A3 protein CTD PMID:21683754 and PMID:28993852 Slc16a3 Rat trichostatin A increases expression ISO SLC16A3 (Homo sapiens) 6480464 trichostatin A results in increased expression of SLC16A3 mRNA CTD PMID:24935251 Slc16a3 Rat trichostatin A multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SLC16A3 mRNA CTD PMID:27188386 Slc16a3 Rat trimellitic anhydride increases expression ISO Slc16a3 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of SLC16A3 mRNA CTD PMID:19042947 Slc16a3 Rat triphenyl phosphate affects expression ISO SLC16A3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SLC16A3 mRNA CTD PMID:37042841 Slc16a3 Rat triptonide decreases expression ISO Slc16a3 (Mus musculus) 6480464 triptonide results in decreased expression of SLC16A3 mRNA CTD PMID:33045310 Slc16a3 Rat undecane increases expression EXP 6480464 undecane results in increased expression of SLC16A3 protein CTD PMID:17337753 Slc16a3 Rat valproic acid increases methylation ISO SLC16A3 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of SLC16A3 gene CTD PMID:29154799 Slc16a3 Rat valproic acid multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SLC16A3 mRNA CTD PMID:27188386 Slc16a3 Rat valproic acid increases expression ISO SLC16A3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SLC16A3 mRNA CTD PMID:23179753 more ... Slc16a3 Rat valproic acid affects expression ISO SLC16A3 (Homo sapiens) 6480464 Valproic Acid affects the expression of SLC16A3 mRNA CTD PMID:25979313 Slc16a3 Rat zidovudine decreases expression ISO SLC16A3 (Homo sapiens) 6480464 Zidovudine results in decreased expression of SLC16A3 mRNA CTD PMID:24292225 Slc16a3 Rat zinc acetate multiple interactions ISO Slc16a3 (Mus musculus) 6480464 [Zinc Acetate results in increased abundance of Zinc] inhibits the reaction [[lead acetate results in increased abundance of Lead] which results in increased expression of SLC16A3 protein] CTD PMID:34508822 Slc16a3 Rat zinc atom multiple interactions ISO Slc16a3 (Mus musculus) 6480464 [Zinc Acetate results in increased abundance of Zinc] inhibits the reaction [[lead acetate results in increased abundance of Lead] which results in increased expression of SLC16A3 protein] CTD PMID:34508822 Slc16a3 Rat zinc dichloride multiple interactions ISO SLC16A3 (Homo sapiens) 6480464 zinc chloride inhibits the reaction [cobaltous chloride results in increased expression of SLC16A3 mRNA] CTD PMID:22202117 Slc16a3 Rat zinc(0) multiple interactions ISO Slc16a3 (Mus musculus) 6480464 [Zinc Acetate results in increased abundance of Zinc] inhibits the reaction [[lead acetate results in increased abundance of Lead] which results in increased expression of SLC16A3 protein] CTD PMID:34508822
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-D (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dimethoxyphenol (ISO) 2-hydroxypropanoic acid (ISO) 3,3',5-triiodo-L-thyronine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 5-methyl-4-oxido-2-pyrazin-4-iumcarboxylic acid (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (EXP) acetamide (EXP) acrolein (ISO) acrylamide (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) alpha-Zearalanol (EXP) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) Azoxymethane (ISO) benzene (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bruceine D (ISO) Butylbenzyl phthalate (ISO) cadmium atom (ISO) cadmium dichloride (ISO) captan (ISO) carbon nanotube (ISO) celecoxib (ISO) CGP 52608 (ISO) chlordecone (ISO) chloropicrin (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (ISO) cobalt dichloride (ISO) cocaine (EXP) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) corilagin (EXP) coumarin (ISO) cyclosporin A (ISO) cypermethrin (ISO) cytarabine (ISO) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) diethyl phthalate (ISO) diethylstilbestrol (EXP) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dinophysistoxin 1 (ISO) dioxygen (EXP,ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) entinostat (ISO) folic acid (ISO) folpet (ISO) FR900359 (ISO) fulvestrant (ISO) furfural (ISO) genistein (ISO) glycidol (EXP) GW 4064 (ISO) hydrogen peroxide (ISO) indometacin (ISO) ivermectin (ISO) L-methionine (ISO) lanthanum trichloride (EXP) lead diacetate (ISO) lead(0) (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) menadione (ISO) mercury dibromide (ISO) methylmercury chloride (ISO) Monobutylphthalate (ISO) N-methyl-4-phenylpyridinium (EXP,ISO) N-methyl-N'-nitro-N-nitrosoguanidine (EXP) N-Nitrosopyrrolidine (ISO) naphthalenes (EXP) nickel atom (ISO) nickel dichloride (ISO) nitrofen (EXP) oxaliplatin (EXP) ozone (ISO) paracetamol (ISO) paraquat (EXP) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (EXP) phenylephrine (EXP) potassium chromate (ISO) prostaglandin E2 (ISO) quercetin (EXP,ISO) rac-lactic acid (ISO) SB 431542 (ISO) serpentine asbestos (ISO) silicon dioxide (EXP,ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium dichromate (ISO) Soman (EXP) sulfadimethoxine (EXP) tamibarotene (ISO) temozolomide (ISO) tetrachloromethane (ISO) thiram (ISO) titanium dioxide (EXP,ISO) topotecan (EXP) tributylstannane (EXP) trichostatin A (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) triptonide (ISO) undecane (EXP) valproic acid (ISO) zidovudine (ISO) zinc acetate (ISO) zinc atom (ISO) zinc dichloride (ISO) zinc(0) (ISO)
1.
A novel postsynaptic density protein: the monocarboxylate transporter MCT2 is co-localized with delta-glutamate receptors in postsynaptic densities of parallel fiber-Purkinje cell synapses.
Bergersen L, etal., Exp Brain Res. 2001 Feb;136(4):523-34.
2.
The low-affinity monocarboxylate transporter MCT4 is adapted to the export of lactate in highly glycolytic cells.
Dimmer KS, etal., Biochem J. 2000 Aug 15;350 Pt 1:219-27.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
CD147 is tightly associated with lactate transporters MCT1 and MCT4 and facilitates their cell surface expression.
Kirk P, etal., EMBO J. 2000 Aug 1;19(15):3896-904.
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
AR-C155858 is a potent inhibitor of monocarboxylate transporters MCT1 and MCT2 that binds to an intracellular site involving transmembrane helices 7-10.
Ovens MJ, etal., Biochem J. 2010 Jan 15;425(3):523-30. doi: 10.1042/BJ20091515.
8.
GOA pipeline
RGD automated data pipeline
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Lactic acid efflux from white skeletal muscle is catalyzed by the monocarboxylate transporter isoform MCT3.
Wilson MC, etal., J Biol Chem 1998 Jun 26;273(26):15920-6.
Slc16a3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 106,712,328 - 106,756,168 (+) NCBI GRCr8 mRatBN7.2 10 106,212,679 - 106,222,564 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 106,212,778 - 106,222,562 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 111,318,174 - 111,326,740 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 110,781,213 - 110,789,779 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 106,134,447 - 106,143,022 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 110,138,519 - 110,148,360 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 110,138,586 - 110,148,358 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 109,726,073 - 109,735,892 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 110,159,679 - 110,163,182 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 110,174,182 - 110,177,686 (+) NCBI Celera 10 104,753,007 - 104,761,582 (+) NCBI Celera Cytogenetic Map 10 q32.3 NCBI
SLC16A3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 82,217,934 - 82,240,086 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 82,217,934 - 82,261,129 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 80,186,311 - 80,197,962 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 77,779,582 - 77,790,658 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 77,780,235 - 77,790,640 NCBI Celera 17 76,780,516 - 76,791,586 (+) NCBI Celera Cytogenetic Map 17 q25.3 NCBI HuRef 17 75,585,945 - 75,596,959 (+) NCBI HuRef CHM1_1 17 80,272,024 - 80,283,105 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 83,097,177 - 83,108,820 (+) NCBI T2T-CHM13v2.0
Slc16a3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 120,839,310 - 120,849,826 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 120,839,306 - 120,851,694 (+) Ensembl GRCm39 Ensembl GRCm38 11 120,948,484 - 120,959,000 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 120,948,480 - 120,960,868 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 120,809,798 - 120,820,314 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 120,764,574 - 120,775,090 (+) NCBI MGSCv36 mm8 Celera 11 132,685,655 - 132,696,171 (+) NCBI Celera Cytogenetic Map 11 E2 NCBI cM Map 11 84.73 NCBI
Slc16a3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955506 935,783 - 945,029 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955506 935,783 - 945,014 (-) NCBI ChiLan1.0 ChiLan1.0
SLC16A3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 98,768,145 - 98,779,315 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 103,669,708 - 103,680,875 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 76,638,030 - 76,649,159 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 82,458,711 - 82,462,221 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 82,458,737 - 82,461,721 (+) Ensembl panpan1.1 panPan2
SLC16A3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 109,557 - 119,179 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 110,345 - 117,352 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 712,817 - 724,127 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 704,211 - 715,519 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 704,661 - 710,915 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 729,268 - 740,577 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 859,232 - 870,540 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 934,334 - 945,639 (-) NCBI UU_Cfam_GSD_1.0
Slc16a3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 690,616 - 698,683 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936594 5,716,935 - 5,721,343 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936594 5,715,234 - 5,721,343 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SLC16A3
SLC16A3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 74,146,799 - 74,157,626 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 74,150,110 - 74,158,112 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 45,743,496 - 45,754,341 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Slc16a3
.
Predicted Target Of
Count of predictions: 99 Count of miRNA genes: 74 Interacting mature miRNAs: 91 Transcripts: ENSRNOT00000054939 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 12880384 Cm107 Cardiac mass QTL 107 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 90404397 107211142 Rat 12880385 Cm108 Cardiac mass QTL 108 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 90404397 107211142 Rat 1354641 Bvd2 Brain ventricular dilatation QTL 2 6.36 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 10 93223816 107057807 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 2303589 Bw87 Body weight QTL 87 2 body mass (VT:0001259) body weight (CMO:0000012) 10 81285008 107211142 Rat 12880396 Am13 Aortic mass QTL 13 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 90404397 107211142 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 12880398 Kidm67 Kidney mass QTL 67 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 10 90404397 107211142 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 12880395 Cm109 Cardiac mass QTL 109 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 10 90404397 107211142 Rat 1579915 Bp280 Blood pressure QTL 280 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90404397 107211142 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 2298548 Neuinf7 Neuroinflammation QTL 7 3.4 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 10 72224939 107211142 Rat 1302404 Cia27 Collagen induced arthritis QTL 27 2.6 0.0045 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 10 76452683 107211142 Rat 2317754 Glom25 Glomerulus QTL 25 3.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 82685200 107211142 Rat 634320 Niddm49 Non-insulin dependent diabetes mellitus QTL 49 4.41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 10 88539139 107211142 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 4889492 Pancm2 Pancreatic morphology QTL 2 3.2 pancreatic beta cell morphology trait (VT:0005217) ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814) 10 76748906 107211142 Rat 6893366 Bw106 Body weight QTL 106 0.3 0.47 body mass (VT:0001259) body weight (CMO:0000012) 10 70199100 107211142 Rat 10450493 Bp382 Blood pressure QTL 382 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 94759759 107211142 Rat 1578672 Bmd16 Bone mineral density QTL 16 6.2 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 96703043 107057807 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 70193 Mcs7 Mammary carcinoma susceptibility QTL 7 2.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 72224939 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 61363 Oia3 Oil induced arthritis QTL 3 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87307617 107211142 Rat 2292438 Bp311 Blood pressure QTL 311 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 107211142 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2292436 Bp310 Blood pressure QTL 310 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 94759759 107211142 Rat 724530 Bp149 Blood pressure QTL 149 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90627439 107211142 Rat 1300137 Bp186 Blood pressure QTL 186 3.57 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 10 90627439 107057807 Rat 631538 Oia5 Oil induced arthritis QTL 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87055121 107211142 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 1578663 Bss18 Bone structure and strength QTL 18 3.6 femur width (VT:1000666) femoral neck width (CMO:0001695) 10 96703043 107057807 Rat
UniSTS:461932
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 106,220,184 - 106,220,751 (+) MAPPER mRatBN7.2 Rnor_6.0 10 110,145,981 - 110,146,547 NCBI Rnor6.0 Rnor_5.0 10 109,733,513 - 109,734,079 UniSTS Rnor5.0 RGSC_v3.4 10 110,160,805 - 110,161,371 UniSTS RGSC3.4 Celera 10 104,759,205 - 104,759,771 UniSTS Cytogenetic Map 10 q32.3 UniSTS
UniSTS:461931
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 106,220,184 - 106,220,720 (+) MAPPER mRatBN7.2 Rnor_6.0 10 110,145,981 - 110,146,516 NCBI Rnor6.0 Rnor_5.0 10 109,733,513 - 109,734,048 UniSTS Rnor5.0 RGSC_v3.4 10 110,160,805 - 110,161,340 UniSTS RGSC3.4 Celera 10 104,759,205 - 104,759,740 UniSTS Cytogenetic Map 10 q32.3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000054939 ⟹ ENSRNOP00000051822
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 106,213,987 - 106,222,562 (+) Ensembl Rnor_6.0 Ensembl 10 110,139,783 - 110,148,358 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000086096 ⟹ ENSRNOP00000069286
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 106,212,778 - 106,222,562 (+) Ensembl Rnor_6.0 Ensembl 10 110,138,586 - 110,148,358 (+) Ensembl
RefSeq Acc Id:
NM_030834 ⟹ NP_110461
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 106,712,328 - 106,720,903 (+) NCBI mRatBN7.2 10 106,213,987 - 106,222,562 (+) NCBI Rnor_6.0 10 110,139,783 - 110,148,358 (+) NCBI Rnor_5.0 10 109,726,073 - 109,735,892 (+) NCBI RGSC_v3.4 10 110,159,679 - 110,163,182 (+) RGD Celera 10 104,753,007 - 104,761,582 (+) RGD
Sequence:
AGGATGAGCAGTGACTACTCGTACACCGCTAGGATGTTGGGCAAAGGGGCACTGATGACACTACCAAGGTGAAACCAGCCCTCCTGGCCATGGGAGGAGCTGTGGTGGACGAGGGTCCCACCGGCATC
hide sequence
RefSeq Acc Id:
XM_063269934 ⟹ XP_063126004
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 106,717,423 - 106,756,168 (+) NCBI
RefSeq Acc Id:
XM_063269935 ⟹ XP_063126005
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 106,717,423 - 106,756,168 (+) NCBI
RefSeq Acc Id:
NP_110461 ⟸ NM_030834
- UniProtKB:
O35910 (UniProtKB/Swiss-Prot), B4F761 (UniProtKB/TrEMBL)
- Sequence:
MGGAVVDEGPTGIKAPDGGWGWAVLFGCFIITGFSYAFPKAVSVFFKELMHEFGIGYSDTAWISSILLAMLYGTGPLCSMCVNRFGCRPVMLVGGLFASLGMVAASFCRSIIQIYLTTGVITGLGLAL
hide sequence
Ensembl Acc Id:
ENSRNOP00000051822 ⟸ ENSRNOT00000054939
Ensembl Acc Id:
ENSRNOP00000069286 ⟸ ENSRNOT00000086096
RefSeq Acc Id:
XP_063126005 ⟸ XM_063269935
- Peptide Label:
isoform X1
- UniProtKB:
O35910 (UniProtKB/Swiss-Prot), B4F761 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063126004 ⟸ XM_063269934
- Peptide Label:
isoform X1
- UniProtKB:
O35910 (UniProtKB/Swiss-Prot), B4F761 (UniProtKB/TrEMBL)
RGD ID: 13697995 Promoter ID: EPDNEW_R8506 Type: multiple initiation site Name: Slc16a3_1 Description: solute carrier family 16 member 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 110,138,570 - 110,138,630 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-09
Slc16a3
solute carrier family 16 member 3
Slc16a3
solute carrier family 16 (monocarboxylate transporter), member 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-08-02
Slc16a3
solute carrier family 16 (monocarboxylate transporter), member 3
Slc16a3
solute carrier family 16, member 3 (monocarboxylic acid transporter 4)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-19
Slc16a3
solute carrier family 16, member 3 (monocarboxylic acid transporter 4)
Slc16a3
solute carrier family 16 (monocarboxylic acid transporters), member 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Slc16a3
solute carrier family 16 (monocarboxylic acid transporters), member 3
monocarboxylate transporter
Name updated
1299863 APPROVED
2004-09-10
Slc16a3
monocarboxylate transporter
Mct3
Symbol and Name updated
1299863 APPROVED
2002-08-07
Mct3
monocarboxylate transporter
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
expressed in all muscle fibers, and in tissues requiring rapid lactic acid efflux
633258
