Symbol:
Fntb (Ensembl: Churc1)
Name:
farnesyltransferase, CAAX box, subunit beta (Ensembl:churchill domain containing 1)
RGD ID:
620119
Description:
Contributes to peptide binding activity and protein farnesyltransferase activity. Involved in positive regulation of cell cycle and positive regulation of cell population proliferation. Predicted to be part of microtubule associated complex and protein farnesyltransferase complex. Human ortholog(s) of this gene implicated in anxiety disorder. Orthologous to several human genes including FNTB (farnesyltransferase, CAAX box, subunit beta); INTERACTS WITH (S)-(-)-perillyl alcohol; 1,2,4-trimethylbenzene; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
CAAX farnesyltransferase subunit beta; farnesyltransferase beta subunit; farnesyltransferase, CAAX box, beta; FTase-beta; MGC105303; protein farnesyltransferase subunit beta; ras proteins prenyltransferase subunit beta
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FNTB (farnesyltransferase, CAAX box, subunit beta) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Fntb (farnesyltransferase, CAAX box, beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fntb (farnesyltransferase, CAAX box, subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FNTB (farnesyltransferase, CAAX box, subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FNTB (farnesyltransferase, CAAX box, beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
LOC101978376 (protein farnesyltransferase subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FNTB (farnesyltransferase, CAAX box, beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FNTB (farnesyltransferase, CAAX box, subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Fntb (farnesyltransferase, CAAX box, subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CHURC1 (churchill domain containing 1) HGNC
EggNOG, Inparanoid, OrthoDB, Treefam
Homo sapiens (human):
CHURC1-FNTB (CHURC1-FNTB readthrough) HGNC
EggNOG, OrthoDB
Alliance orthologs 3
Mus musculus (house mouse):
Fntb (farnesyltransferase, CAAX box, beta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
FNTB (farnesyltransferase, CAAX box, subunit beta)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CHURC1-FNTB (CHURC1-FNTB readthrough)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fntb (farnesyltransferase, CAAX box, beta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG17565
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RAM1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
fntb-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
fntb
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 101,269,657 - 101,352,716 (+) NCBI GRCr8 mRatBN7.2 6 95,536,540 - 95,619,587 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 95,470,683 - 95,619,586 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 95,925,102 - 96,014,540 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 96,223,633 - 96,313,088 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 95,652,452 - 95,741,900 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 99,883,959 - 99,966,988 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 99,883,959 - 99,966,988 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 109,278,424 - 109,361,572 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 99,427,967 - 99,511,373 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 99,431,422 - 99,514,829 (+) NCBI Celera 6 93,954,767 - 94,037,720 (+) NCBI Celera Cytogenetic Map 6 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Fntb Rat (S)-(-)-perillyl alcohol multiple interactions EXP 6480464 [perillyl alcohol co-treated with Vitamin A] results in decreased expression of FNTB mRNA CTD PMID:15959631 Fntb Rat (S)-(-)-perillyl alcohol increases expression EXP 6480464 perillyl alcohol results in increased expression of FNTB protein CTD PMID:15959631 Fntb Rat (S)-(-)-perillyl alcohol decreases expression EXP 6480464 perillyl alcohol results in decreased expression of FNTB mRNA CTD PMID:15959631 Fntb Rat 1,2,4-trimethylbenzene decreases expression EXP 6480464 pseudocumene results in decreased expression of FNTB protein CTD PMID:17337753 Fntb Rat 1,2-dimethylhydrazine affects expression ISO RGD:732388 6480464 1,2-Dimethylhydrazine affects the expression of FNTB mRNA CTD PMID:22206623 Fntb Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of FNTB mRNA CTD PMID:32145629 Fntb Rat 2,2',5,5'-tetrachlorobiphenyl increases expression EXP 6480464 2,5,2',5'-tetrachlorobiphenyl results in increased expression of FNTB mRNA CTD PMID:23829299 Fntb Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:732388 6480464 Tetrachlorodibenzodioxin affects the expression of FNTB mRNA CTD PMID:21570461 Fntb Rat 2-hydroxypropanoic acid decreases expression ISO RGD:736901 6480464 Lactic Acid results in decreased expression of FNTB mRNA CTD PMID:30851411 Fntb Rat 2-methylcholine affects expression ISO RGD:736901 6480464 beta-methylcholine affects the expression of FNTB mRNA CTD PMID:21179406 Fntb Rat 2-trans,6-trans-farnesyl diphosphate multiple interactions EXP 6480464 [FNTA protein binds to FNTB protein] binds to [farnesyl pyrophosphate analog co-treated with KRAS protein] CTD PMID:10673434 Fntb Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of FNTB mRNA CTD PMID:33354967 Fntb Rat alachlor increases expression EXP 6480464 alachlor results in increased expression of FNTB mRNA CTD PMID:12419858 Fntb Rat all-trans-retinoic acid decreases expression ISO RGD:736901 6480464 Tretinoin results in decreased expression of FNTB mRNA CTD PMID:33167477 Fntb Rat all-trans-retinol multiple interactions EXP 6480464 [perillyl alcohol co-treated with Vitamin A] results in decreased expression of FNTB mRNA CTD PMID:15959631 Fntb Rat all-trans-retinol increases expression EXP 6480464 Vitamin A results in increased expression of FNTB mRNA; Vitamin A results in increased expression more ... CTD PMID:15959631 Fntb Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of FNTB mRNA CTD PMID:16483693 Fntb Rat atrazine decreases expression ISO RGD:736901 6480464 Atrazine results in decreased expression of FNTB mRNA CTD PMID:22378314 Fntb Rat benzo[a]pyrene increases expression ISO RGD:732388 6480464 Benzo(a)pyrene results in increased expression of FNTB mRNA CTD PMID:22228805 Fntb Rat benzo[a]pyrene decreases methylation ISO RGD:736901 6480464 Benzo(a)pyrene results in decreased methylation of FNTB promoter CTD PMID:27901495 Fntb Rat benzo[a]pyrene decreases expression ISO RGD:736901 6480464 Benzo(a)pyrene results in decreased expression of FNTB mRNA CTD PMID:21632981 Fntb Rat benzo[e]pyrene decreases methylation ISO RGD:736901 6480464 benzo(e)pyrene results in decreased methylation of FNTB intron CTD PMID:30157460 Fntb Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of FNTB mRNA CTD PMID:25181051 Fntb Rat bisphenol A affects expression ISO RGD:736901 6480464 bisphenol A affects the expression of FNTB mRNA CTD PMID:30903817 Fntb Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of FNTB gene CTD PMID:28505145 Fntb Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of FNTB mRNA CTD PMID:19167457 Fntb Rat cadmium atom decreases expression ISO RGD:732388 6480464 Cadmium results in decreased expression of FNTB mRNA CTD PMID:24067728 Fntb Rat carbon nanotube increases expression ISO RGD:732388 6480464 Nanotubes, Carbon results in increased expression of FNTB mRNA CTD PMID:25554681 Fntb Rat CGP 52608 multiple interactions ISO RGD:736901 6480464 CGP 52608 promotes the reaction [RORA protein binds to FNTB gene] CTD PMID:28238834 Fntb Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of FNTB mRNA CTD PMID:18668222 Fntb Rat chlorpyrifos increases expression ISO RGD:732388 6480464 Chlorpyrifos results in increased expression of FNTB mRNA CTD PMID:37019170 Fntb Rat cisplatin increases expression ISO RGD:736901 6480464 Cisplatin results in increased expression of FNTB mRNA CTD PMID:27392435 Fntb Rat copper(II) sulfate decreases expression ISO RGD:736901 6480464 Copper Sulfate results in decreased expression of FNTB mRNA CTD PMID:19549813 Fntb Rat curcumin increases expression ISO RGD:736901 6480464 Curcumin results in increased expression of FNTB mRNA CTD PMID:17999991 Fntb Rat Dibutyl phosphate affects expression ISO RGD:736901 6480464 di-n-butylphosphoric acid affects the expression of FNTB mRNA CTD PMID:37042841 Fntb Rat doxorubicin decreases expression ISO RGD:736901 6480464 Doxorubicin results in decreased expression of FNTB mRNA CTD PMID:29803840 Fntb Rat entinostat increases expression ISO RGD:736901 6480464 entinostat results in increased expression of FNTB mRNA CTD PMID:27188386 Fntb Rat ethanol affects splicing ISO RGD:732388 6480464 Ethanol affects the splicing of FNTB mRNA CTD PMID:30319688 Fntb Rat ethyl methanesulfonate increases expression ISO RGD:736901 6480464 Ethyl Methanesulfonate results in increased expression of FNTB mRNA CTD PMID:23649840 Fntb Rat farnesol decreases expression ISO RGD:736901 6480464 Farnesol analog results in decreased expression of FNTB mRNA CTD PMID:30611723 Fntb Rat farnesyl diphosphate multiple interactions EXP 6480464 [FNTA protein binds to FNTB protein] binds to [farnesyl pyrophosphate analog co-treated with KRAS protein] CTD PMID:10673434 Fntb Rat fenthion decreases expression ISO RGD:732388 6480464 Fenthion results in decreased expression of FNTB mRNA CTD PMID:34813904 Fntb Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of FNTB mRNA CTD PMID:18035473 Fntb Rat folic acid decreases expression ISO RGD:732388 6480464 Folic Acid results in decreased expression of FNTB mRNA CTD PMID:25629700 Fntb Rat formaldehyde increases expression ISO RGD:736901 6480464 Formaldehyde results in increased expression of FNTB mRNA CTD PMID:23649840 Fntb Rat graphite affects expression EXP 6480464 Graphite affects the expression of FNTB mRNA CTD PMID:29933104 Fntb Rat GW 4064 multiple interactions ISO RGD:736901 6480464 [GW 4064 co-treated with Oleic Acid] results in decreased expression of FNTB mRNA CTD PMID:30611723 Fntb Rat hydrogen peroxide multiple interactions ISO RGD:736901 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in increased expression of FNTB protein CTD PMID:18951874 Fntb Rat iron atom increases expression EXP 6480464 Iron deficiency results in increased expression of FNTB mRNA CTD PMID:16629162 Fntb Rat iron(0) increases expression EXP 6480464 Iron deficiency results in increased expression of FNTB mRNA CTD PMID:16629162 Fntb Rat methapyrilene decreases methylation ISO RGD:736901 6480464 Methapyrilene results in decreased methylation of FNTB intron CTD PMID:30157460 Fntb Rat methyl methanesulfonate increases expression ISO RGD:736901 6480464 Methyl Methanesulfonate results in increased expression of FNTB mRNA CTD PMID:23649840 Fntb Rat oleic acid multiple interactions ISO RGD:736901 6480464 [GW 4064 co-treated with Oleic Acid] results in decreased expression of FNTB mRNA CTD PMID:30611723 Fntb Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of FNTB mRNA CTD PMID:25729387 Fntb Rat perfluorohexanesulfonic acid decreases expression ISO RGD:732388 6480464 perfluorohexanesulfonic acid results in decreased expression of FNTB mRNA CTD PMID:37995155 Fntb Rat perillyl alcohol multiple interactions EXP 6480464 [perillyl alcohol co-treated with Vitamin A] results in decreased expression of FNTB mRNA CTD PMID:15959631 Fntb Rat perillyl alcohol increases expression EXP 6480464 perillyl alcohol results in increased expression of FNTB protein CTD PMID:15959631 Fntb Rat perillyl alcohol decreases expression EXP 6480464 perillyl alcohol results in decreased expression of FNTB mRNA CTD PMID:15959631 Fntb Rat rac-lactic acid decreases expression ISO RGD:736901 6480464 Lactic Acid results in decreased expression of FNTB mRNA CTD PMID:30851411 Fntb Rat sodium arsenite decreases expression ISO RGD:732388 6480464 sodium arsenite results in decreased expression of FNTB mRNA CTD PMID:25270620 Fntb Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of FNTB mRNA CTD PMID:19281266 Fntb Rat temozolomide increases expression ISO RGD:736901 6480464 Temozolomide results in increased expression of FNTB mRNA CTD PMID:31758290 Fntb Rat theophylline multiple interactions ISO RGD:736901 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in increased expression of FNTB protein CTD PMID:18951874 Fntb Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of FNTB mRNA CTD PMID:25729387 Fntb Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of FNTB mRNA CTD PMID:25729387 Fntb Rat valproic acid affects expression ISO RGD:732388 6480464 Valproic Acid affects the expression of FNTB mRNA CTD PMID:17292431 Fntb Rat valproic acid affects expression ISO RGD:736901 6480464 Valproic Acid affects the expression of FNTB mRNA CTD PMID:25979313 Fntb Rat zinc atom multiple interactions EXP 6480464 Zinc binds to and results in increased activity of [FNTA protein binds to FNTB protein] CTD PMID:10673434 Fntb Rat zinc(0) multiple interactions EXP 6480464 Zinc binds to and results in increased activity of [FNTA protein binds to FNTB protein] CTD PMID:10673434
(S)-(-)-perillyl alcohol (EXP) 1,2,4-trimethylbenzene (EXP) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 2-trans,6-trans-farnesyl diphosphate (EXP) aflatoxin B1 (EXP) alachlor (EXP) all-trans-retinoic acid (ISO) all-trans-retinol (EXP) ammonium chloride (EXP) atrazine (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) C60 fullerene (EXP) cadmium atom (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (EXP,ISO) cisplatin (ISO) copper(II) sulfate (ISO) curcumin (ISO) Dibutyl phosphate (ISO) doxorubicin (ISO) entinostat (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) farnesol (ISO) farnesyl diphosphate (EXP) fenthion (ISO) flavonoids (EXP) folic acid (ISO) formaldehyde (ISO) graphite (EXP) GW 4064 (ISO) hydrogen peroxide (ISO) iron atom (EXP) iron(0) (EXP) methapyrilene (ISO) methyl methanesulfonate (ISO) oleic acid (ISO) oxaliplatin (EXP) perfluorohexanesulfonic acid (ISO) perillyl alcohol (EXP) rac-lactic acid (ISO) sodium arsenite (ISO) Soman (EXP) temozolomide (ISO) theophylline (ISO) topotecan (EXP) valproic acid (ISO) zinc atom (EXP) zinc(0) (EXP)
1.
cDNA cloning and expression of the peptide-binding beta subunit of rat p21ras farnesyltransferase, the counterpart of yeast DPR1/RAM1.
Chen WJ, etal., Cell 1991 Jul 26;66(2):327-34.
2.
Novel and selective imidazole-containing biphenyl inhibitors of protein farnesyltransferase.
Curtin ML, etal., Bioorg Med Chem Lett. 2003 Apr 7;13(7):1367-71.
3.
Isothiazole dioxide derivative 6n inhibits vascular smooth muscle cell proliferation and protein farnesylation.
Ferri N, etal., Biochem Pharmacol. 2005 Dec 5;70(12):1735-43. Epub 2005 Oct 28.
4.
Inhibition of protein geranylgeranylation causes a superinduction of nitric-oxide synthase-2 by interleukin-1beta in vascular smooth muscle cells.
Finder JD, etal., J Biol Chem. 1997 May 23;272(21):13484-8.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
Aryl tetrahydropyridine inhibitors of farnesyltransferase: glycine, phenylalanine and histidine derivatives.
Gwaltney SL 2nd, etal., Bioorg Med Chem Lett. 2003 Apr 7;13(7):1359-62.
8.
Aryl tetrahydropyridine inhibitors of farnesyltransferase: bioavailable analogues with improved cellular potency.
Gwaltney SL 2nd, etal., Bioorg Med Chem Lett. 2003 Apr 7;13(7):1363-6.
9.
Mutation burden analysis of six common mental disorders in African Americans by whole genome sequencing.
Liu Y, etal., Hum Mol Genet. 2022 Nov 10;31(22):3769-3776. doi: 10.1093/hmg/ddac129.
10.
The basis for K-Ras4B binding specificity to protein farnesyltransferase revealed by 2 A resolution ternary complex structures.
Long SB, etal., Structure. 2000 Feb 15;8(2):209-22.
11.
Combination of the novel farnesyltransferase inhibitor RPR130401 and the geranylgeranyltransferase-1 inhibitor GGTI-298 disrupts MAP kinase activation and G(1)-S transition in Ki-Ras-overexpressing transformed adrenocortical cells.
Mazet JL, etal., FEBS Lett. 1999 Oct 29;460(2):235-40.
12.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
13.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.
Crystal structure of protein farnesyltransferase at 2.25 angstrom resolution.
Park HW, etal., Science. 1997 Mar 21;275(5307):1800-4.
15.
Crystal structures of the anticancer clinical candidates R115777 (Tipifarnib) and BMS-214662 complexed with protein farnesyltransferase suggest a mechanism of FTI selectivity.
Reid TS and Beese LS, Biochemistry. 2004 Jun 8;43(22):6877-84.
16.
Crystallographic analysis reveals that anticancer clinical candidate L-778,123 inhibits protein farnesyltransferase and geranylgeranyltransferase-I by different binding modes.
Reid TS, etal., Biochemistry. 2004 Jul 20;43(28):9000-8.
17.
Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
Reid TS, etal., J Mol Biol. 2004 Oct 15;343(2):417-33.
18.
GOA pipeline
RGD automated data pipeline
19.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
20.
Role of the carboxyterminal residue in peptide binding to protein farnesyltransferase and protein geranylgeranyltransferase.
Roskoski R Jr and Ritchie P, Arch Biochem Biophys. 1998 Aug 15;356(2):167-76.
21.
Tricyclic farnesyl protein transferase inhibitors: crystallographic and calorimetric studies of structure-activity relationships.
Strickland CL, etal., J Med Chem. 1999 Jun 17;42(12):2125-35.
22.
Discovery of potent imidazole and cyanophenyl containing farnesyltransferase inhibitors with improved oral bioavailability.
Tong Y, etal., Bioorg Med Chem Lett. 2003 May 5;13(9):1571-4.
23.
Biochemical and structural studies with prenyl diphosphate analogues provide insights into isoprenoid recognition by protein farnesyl transferase.
Turek-Etienne TC, etal., Biochemistry. 2003 Apr 8;42(13):3716-24.
24.
Properties and kinetic mechanism of recombinant mammalian protein geranylgeranyltransferase type I.
Zhang FL, etal., J Biol Chem. 1994 Sep 23;269(38):23465-70.
25.
TrkB-mediated activation of geranylgeranyltransferase I promotes dendritic morphogenesis.
Zhou XP, etal., Proc Natl Acad Sci U S A. 2008 Nov 4;105(44):17181-6. Epub 2008 Oct 28.
Fntb Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 101,269,657 - 101,352,716 (+) NCBI GRCr8 mRatBN7.2 6 95,536,540 - 95,619,587 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 95,470,683 - 95,619,586 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 95,925,102 - 96,014,540 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 96,223,633 - 96,313,088 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 95,652,452 - 95,741,900 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 99,883,959 - 99,966,988 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 99,883,959 - 99,966,988 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 109,278,424 - 109,361,572 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 99,427,967 - 99,511,373 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 99,431,422 - 99,514,829 (+) NCBI Celera 6 93,954,767 - 94,037,720 (+) NCBI Celera Cytogenetic Map 6 q24 NCBI
FNTB Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 64,986,895 - 65,062,650 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 64,986,895 - 65,062,652 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 65,453,613 - 65,529,368 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 64,523,260 - 64,599,123 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 64,523,259 - 64,599,122 NCBI Celera 14 45,508,091 - 45,583,963 (+) NCBI Celera Cytogenetic Map 14 q23.3 NCBI HuRef 14 45,622,838 - 45,698,636 (+) NCBI HuRef CHM1_1 14 65,391,707 - 65,467,529 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 59,191,767 - 59,267,508 (+) NCBI T2T-CHM13v2.0
Fntb Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 76,884,014 - 76,968,188 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 76,812,363 - 76,968,186 (+) Ensembl GRCm39 Ensembl GRCm38 12 76,837,400 - 76,921,412 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 76,765,589 - 76,921,412 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 77,938,454 - 78,022,399 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 77,756,307 - 77,840,252 (+) NCBI MGSCv36 mm8 Celera 12 77,919,908 - 78,003,339 (+) NCBI Celera Cytogenetic Map 12 C3 NCBI cM Map 12 33.73 NCBI
Fntb Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955466 4,855,509 - 5,013,568 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955466 4,858,628 - 4,940,247 (-) NCBI ChiLan1.0 ChiLan1.0
FNTB Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 66,095,351 - 66,174,358 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 65,313,473 - 65,390,871 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 45,568,511 - 45,643,952 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 64,448,173 - 64,522,632 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 64,448,170 - 64,522,632 (+) Ensembl panpan1.1 panPan2
FNTB Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 39,364,067 - 39,429,129 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 39,056,154 - 39,121,139 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 39,586,882 - 39,651,960 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 39,586,923 - 39,651,894 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 39,207,903 - 39,272,691 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 39,280,638 - 39,345,195 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 39,639,759 - 39,704,379 (+) NCBI UU_Cfam_GSD_1.0
LOC101978376 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 65,477,747 - 65,554,529 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936495 8,567,894 - 8,713,978 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936495 8,637,103 - 8,713,952 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FNTB Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 89,052,507 - 89,131,072 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 89,052,451 - 89,131,075 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 95,473,097 - 95,507,362 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FNTB Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 42,197,998 - 42,275,863 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 42,198,704 - 42,276,898 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 30,373,890 - 30,450,958 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fntb
.
Predicted Target Of
Count of predictions: 198 Count of miRNA genes: 133 Interacting mature miRNAs: 166 Transcripts: ENSRNOT00000010588 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 634330 Pia16 Pristane induced arthritis QTL 16 3.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 6 45790088 104200226 Rat 1331789 Rf37 Renal function QTL 37 3.224 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 6 72202632 115200186 Rat 1331725 Bp212 Blood pressure QTL 212 3.52475 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 93701310 128713626 Rat 1331722 Thshl1 Thyroid stimulating hormone level QTL 1 11.7 0.0001 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 6 89762877 106752806 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 70176 Mcsm1 Mammary carcinoma susceptibility modifier QTL 1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 58632962 103632962 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 1558641 Cm47 Cardiac mass QTL 47 2.9 0.001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 6 57730540 104085867 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 724524 Uae2 Urinary albumin excretion QTL 2 2.7 0.0005 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 73463459 109394713 Rat 737827 Hcar11 Hepatocarcinoma resistance QTL 11 4.4 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 6 82523650 110548006 Rat 1641904 Alcrsp4 Alcohol response QTL 4 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 6 67262953 112262953 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 2293837 Kiddil1 Kidney dilation QTL 1 3.7 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 2293842 Kiddil3 Kidney dilation QTL 3 4.3 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 70196 BpQTLcluster7 Blood pressure QTL cluster 7 6.82 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 72202632 117202632 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 1576302 Schws4 Schwannoma susceptibility QTL 4 0.0078 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 83190345 106747639 Rat 1300075 Glom7 Glomerulus QTL 7 5.6 0.0000002 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 6 71201409 116201409 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 12801471 Schws9 Schwannoma susceptibility QTL 9 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 61747639 106747639 Rat 6893332 Cm74 Cardiac mass QTL 74 0.4 0.64 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 57730540 104085867 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat
RH129066
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 95,619,302 - 95,619,489 (+) MAPPER mRatBN7.2 Rnor_6.0 6 99,966,705 - 99,966,891 NCBI Rnor6.0 Rnor_5.0 6 109,361,289 - 109,361,475 UniSTS Rnor5.0 RGSC_v3.4 6 99,511,090 - 99,511,276 UniSTS RGSC3.4 Celera 6 94,037,437 - 94,037,623 UniSTS Cytogenetic Map 6 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000009621 ⟹ ENSRNOP00000009620
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 95,470,683 - 95,485,198 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000010588 ⟹ ENSRNOP00000010588
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 95,536,587 - 95,619,586 (+) Ensembl Rnor_6.0 Ensembl 6 99,883,959 - 99,966,988 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000094814 ⟹ ENSRNOP00000094000
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 95,470,683 - 95,485,559 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000099844 ⟹ ENSRNOP00000079445
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 95,536,587 - 95,619,586 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000104862 ⟹ ENSRNOP00000079737
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 95,476,429 - 95,485,203 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000109454 ⟹ ENSRNOP00000094703
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 95,470,934 - 95,485,192 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000120259 ⟹ ENSRNOP00000080450
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 95,470,683 - 95,619,586 (+) Ensembl
RefSeq Acc Id:
NM_172034 ⟹ NP_742031
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 101,269,722 - 101,352,716 (+) NCBI mRatBN7.2 6 95,536,587 - 95,619,586 (+) NCBI Rnor_6.0 6 99,883,959 - 99,966,988 (+) NCBI Rnor_5.0 6 109,278,424 - 109,361,572 (+) NCBI RGSC_v3.4 6 99,427,967 - 99,511,373 (+) RGD Celera 6 93,954,767 - 94,037,720 (+) RGD
Sequence:
CTGGACGAAGCTGAGTCCTATACAGCGCTCGCAGCTCTCCCGATCATGGCTTCTTCGAGTTCCTTCACCTATTATTGTCCTCCATCTTCTTCCCCTGTTTGGTCAGAACCGCTGTATAGTCTGAGACC
hide sequence
RefSeq Acc Id:
XM_039112877 ⟹ XP_038968805
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 101,269,657 - 101,352,716 (+) NCBI mRatBN7.2 6 95,536,540 - 95,619,587 (+) NCBI
RefSeq Acc Id:
XM_063262446 ⟹ XP_063118516
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 101,270,058 - 101,352,716 (+) NCBI
RefSeq Acc Id:
NP_742031 ⟸ NM_172034
- UniProtKB:
Q02293 (UniProtKB/Swiss-Prot), A6HCB6 (UniProtKB/TrEMBL)
- Sequence:
MASSSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000010588 ⟸ ENSRNOT00000010588
RefSeq Acc Id:
XP_038968805 ⟸ XM_039112877
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZMQ9 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000094000 ⟸ ENSRNOT00000094814
Ensembl Acc Id:
ENSRNOP00000079737 ⟸ ENSRNOT00000104862
Ensembl Acc Id:
ENSRNOP00000009620 ⟸ ENSRNOT00000009621
Ensembl Acc Id:
ENSRNOP00000079445 ⟸ ENSRNOT00000099844
Ensembl Acc Id:
ENSRNOP00000094703 ⟸ ENSRNOT00000109454
Ensembl Acc Id:
ENSRNOP00000080450 ⟸ ENSRNOT00000120259
RefSeq Acc Id:
XP_063118516 ⟸ XM_063262446
- Peptide Label:
isoform X2
RGD ID: 13694682 Promoter ID: EPDNEW_R5207 Type: initiation region Name: Fntb_1 Description: farnesyltransferase, CAAX box, beta SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 99,883,912 - 99,883,972 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-03-29
Fntb
farnesyltransferase, CAAX box, subunit beta
Fntb
farnesyltransferase, CAAX box, beta
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Fntb
farnesyltransferase, CAAX box, beta
farnesyltransferase beta subunit
Name updated
1299863 APPROVED
2002-08-07
Fntb
farnesyltransferase beta subunit
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_protein
437 amino acids
728425
