Symbol:
Bpifa1
Name:
BPI fold containing family A, member 1
RGD ID:
619818
Description:
Predicted to enable lipid binding activity. Predicted to be involved in several processes, including defense response to symbiont; multicellular organismal-level water homeostasis; and negative regulation of single-species biofilm formation in or on host organism. Located in microvillus. Orthologous to human BPIFA1 (BPI fold containing family A member 1); INTERACTS WITH 6-propyl-2-thiouracil; ammonium chloride; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
BPI fold-containing family A member 1; ES cell-related protein; palate lung and nasal epithelium carcinoma associated; palate lung and nasal epithelium clone protein; palate lung and nasal epithelium expressed transcript; palate, lung and nasal epithelium associated; palate, lung, and nasal epithelium associated; palate, lung, and nasal epithelium carcinoma associated; palate, lung, and nasal epithelium expressed transcript; Plunc
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
BPIFA1 (BPI fold containing family A member 1) HGNC
Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Bpifa1 (BPI fold containing family A, member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Bpifa1 (BPI fold containing family A member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
BPIFA1 (BPI fold containing family A member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
BPIFA1 (BPI fold containing family A member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
BPIFA1 (BPI fold containing family A member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
BPIFA1 (BPI fold containing family A member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Bpifa1 (BPI fold containing family A member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
MOCOS (molybdenum cofactor sulfurase) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
BPIFA1 (BPI fold containing family A member 1)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Bpifa1 (BPI fold containing family A, member 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 163,087,965 - 163,093,708 (+) NCBI GRCr8 mRatBN7.2 3 142,627,810 - 142,633,553 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 142,627,810 - 142,633,552 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 146,529,706 - 146,535,449 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 155,113,544 - 155,119,287 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 152,853,782 - 152,859,525 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 149,624,867 - 149,630,610 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 149,624,712 - 149,630,613 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 156,002,440 - 156,008,183 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 144,529,855 - 144,535,598 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 144,435,476 - 144,441,219 (+) NCBI Celera 3 141,369,225 - 141,374,968 (+) NCBI Celera Cytogenetic Map 3 q41 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Biological Process
antibacterial humoral response (IBA,ISO,ISS) antimicrobial humoral immune response mediated by antimicrobial peptide (IBA,ISO) defense response to bacterium (IEA) immune response in nasopharyngeal-associated lymphoid tissue (IBA,ISO) immune system process (IEA) innate immune response (IBA,IEA,ISO,ISS) killing of cells of another organism (ISO) multicellular organismal-level water homeostasis (ISO,ISS) negative regulation of single-species biofilm formation in or on host organism (IBA,ISO,ISS) positive regulation of acute inflammatory response (ISO) regulation of sodium ion transmembrane transport (ISO,ISS) surfactant homeostasis (IBA,ISO,ISS)
Bpifa1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 163,087,965 - 163,093,708 (+) NCBI GRCr8 mRatBN7.2 3 142,627,810 - 142,633,553 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 142,627,810 - 142,633,552 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 146,529,706 - 146,535,449 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 155,113,544 - 155,119,287 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 152,853,782 - 152,859,525 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 149,624,867 - 149,630,610 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 149,624,712 - 149,630,613 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 156,002,440 - 156,008,183 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 144,529,855 - 144,535,598 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 144,435,476 - 144,441,219 (+) NCBI Celera 3 141,369,225 - 141,374,968 (+) NCBI Celera Cytogenetic Map 3 q41 NCBI
BPIFA1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 33,235,996 - 33,243,306 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 33,235,995 - 33,243,311 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 31,823,802 - 31,831,112 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 31,287,463 - 31,294,773 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 31,287,462 - 31,294,772 NCBI Celera 20 28,577,699 - 28,585,012 (+) NCBI Celera Cytogenetic Map 20 q11.21 NCBI HuRef 20 28,611,406 - 28,618,725 (+) NCBI HuRef CHM1_1 20 31,724,914 - 31,732,227 (+) NCBI CHM1_1 T2T-CHM13v2.0 20 34,963,235 - 34,970,520 (+) NCBI T2T-CHM13v2.0
Bpifa1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 153,984,800 - 153,991,137 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 153,984,800 - 153,991,139 (+) Ensembl GRCm39 Ensembl GRCm38 2 154,142,880 - 154,149,217 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 154,142,880 - 154,149,219 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 153,968,616 - 153,974,953 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 153,834,326 - 153,840,658 (+) NCBI MGSCv36 mm8 Celera 2 160,065,103 - 160,071,425 (+) NCBI Celera Cytogenetic Map 2 H1 NCBI cM Map 2 76.15 NCBI
Bpifa1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955422 28,063,077 - 28,069,939 (-) NCBI ChiLan1.0 ChiLan1.0
BPIFA1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 38,929,074 - 38,936,568 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 38,922,172 - 38,929,666 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 29,524,619 - 29,532,996 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 30,641,138 - 30,649,515 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 30,642,191 - 30,649,515 (+) Ensembl panpan1.1 panPan2
BPIFA1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 22,475,407 - 22,482,666 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 22,457,631 - 22,482,661 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 22,121,008 - 22,128,270 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 23,161,382 - 23,168,638 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 23,160,932 - 23,168,633 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 22,436,703 - 22,443,958 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 22,546,960 - 22,554,221 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 22,978,118 - 22,985,370 (+) NCBI UU_Cfam_GSD_1.0
BPIFA1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 36,754,498 - 36,761,621 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 36,754,498 - 36,761,622 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 41,704,827 - 41,711,955 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BPIFA1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 37,571,577 - 37,579,529 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 37,573,837 - 37,578,667 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 89,321,049 - 89,329,502 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Bpifa1
.
Predicted Target Of
Count of predictions: 41 Count of miRNA genes: 36 Interacting mature miRNAs: 39 Transcripts: ENSRNOT00000018581 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 1598877 Bp285 Blood pressure QTL 285 1.5 0.03 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 120538241 165538241 Rat 1578653 Vnigr3 Vascular neointimal growth QTL 3 3.1 artery morphology trait (VT:0002191) artery neointimal hyperplastic lesion area (CMO:0001414) 3 130656562 169034231 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 1298068 Bp167 Blood pressure QTL 167 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 141074471 169034231 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 2298477 Eau4 Experimental allergic uveoretinitis QTL 4 0.0011 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 3 137398739 169034231 Rat 61335 Bp20 Blood pressure QTL 20 3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 141339236 155617360 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1331726 Bp208 Blood pressure QTL 208 3.129 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 141339013 162184794 Rat 1300173 Rf11 Renal function QTL 11 3.38 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 121056165 145956249 Rat 9589106 Insul23 Insulin level QTL 23 13.86 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 3 131635904 169034231 Rat 10755461 Coatc16 Coat color QTL 16 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 3 122438700 167438700 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 2303620 Vencon4 Ventilatory control QTL 4 3.9 respiration trait (VT:0001943) tidal volume (CMO:0000222) 3 127162703 168026850 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1576306 Schws3 Schwannoma susceptibility QTL 3 0.001 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 3 118839124 163839124 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 1300159 Kidm4 Kidney mass QTL 4 3.83 kidney mass (VT:0002707) right kidney wet weight to body weight ratio (CMO:0001953) 3 121056165 157309487 Rat 5686842 Rf59 Renal function QTL 59 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 3 140069424 146976080 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 631673 Iddm13 Insulin dependent diabetes mellitus QTL 13 1.3 0.663 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 3 130193298 161695983 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 1578656 Vnigr2 Vascular neointimal growth QTL 2 4.2 artery morphology trait (VT:0002191) lesioned artery residual lumen area (CMO:0001417) 3 130656562 169034231 Rat 8552952 Pigfal13 Plasma insulin-like growth factor 1 level QTL 13 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 138799500 169034231 Rat 631541 Bp81 Blood pressure QTL 81 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 124122556 169034231 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
1
9
11
70
35
38
8
15
8
1
62
37
60
8
36
30
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000018581 ⟹ ENSRNOP00000018581
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 142,627,810 - 142,633,552 (+) Ensembl Rnor_6.0 Ensembl 3 149,624,712 - 149,630,613 (+) Ensembl
RefSeq Acc Id:
NM_172031 ⟹ NP_742028
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 163,087,965 - 163,093,708 (+) NCBI mRatBN7.2 3 142,627,810 - 142,633,553 (+) NCBI Rnor_6.0 3 149,624,867 - 149,630,610 (+) NCBI Rnor_5.0 3 156,002,440 - 156,008,183 (+) NCBI RGSC_v3.4 3 144,529,855 - 144,535,598 (+) RGD Celera 3 141,369,225 - 141,374,968 (+) RGD
Sequence:
TGCGGCCGCCAGACACCCACTGAGACCTTAAGACTCAGACACCAAGAGAGATGTTTCTAGTTGGGAGTCTTGTCGTCCTCTGTGGGCTGCTGGCCCAGAGCACAGCCCAGCTAGCAGGCCTGCCTTTG
hide sequence
RefSeq Acc Id:
XM_039104251 ⟹ XP_038960179
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 163,088,002 - 163,093,708 (+) NCBI mRatBN7.2 3 142,627,895 - 142,633,553 (+) NCBI
RefSeq Acc Id:
NP_742028 ⟸ NM_172031
- Peptide Label:
precursor
- UniProtKB:
Q8K4I4 (UniProtKB/Swiss-Prot), A6KHX6 (UniProtKB/TrEMBL)
- Sequence:
MFLVGSLVVLCGLLAQSTAQLAGLPLPLGQGLPLPLGQGLPLPLGQGLPLAVSPALPSNPTDLLAGNFANALSGGLLSGGLLGILENIPLLDVIKSGGGSSNGLVGGLLGKLTSSVPLLNNILDIKIT
hide sequence
Ensembl Acc Id:
ENSRNOP00000018581 ⟸ ENSRNOT00000018581
RefSeq Acc Id:
XP_038960179 ⟸ XM_039104251
- Peptide Label:
isoform X1
RGD ID: 13692568 Promoter ID: EPDNEW_R3093 Type: single initiation site Name: Bpifa1_1 Description: BPI fold containing family A, member 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 149,624,851 - 149,624,911 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-08-16
Bpifa1
BPI fold containing family A, member 1
Plunc
palate, lung and nasal epithelium associated
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2011-08-01
Plunc
palate, lung and nasal epithelium associated
Bpifa1
BPI fold containing family A, member 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-11
Plunc
palate, lung, and nasal epithelium associated
Plunc
palate, lung, and nasal epithelium carcinoma associated
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-12-14
Plunc
palate, lung, and nasal epithelium carcinoma associated
palate, lung, and nasal epithelium expressed transcript
Name updated
1299863 APPROVED
2002-08-07
Plunc
palate, lung, and nasal epithelium expressed transcript
Symbol and Name status set to provisional
70820 PROVISIONAL
