Symbol:
Vapa
Name:
VAMP associated protein A
RGD ID:
61803
Description:
Enables identical protein binding activity. Involved in neuron projection development. Located in endoplasmic reticulum membrane and nuclear membrane. Orthologous to human VAPA (VAMP associated protein A); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
33 kDa Vamp-associated protein; VAMP (vesicle-associated membrane protein)-associated protein A; VAMP-A; VAMP-associated protein A; VAP-33; VAP-A; vesicle-associated membrane protein associated protein A (33 kDa); vesicle-associated membrane protein, associated protein a; vesicle-associated membrane protein, associated protein A (33 kDa); vesicle-associated membrane protein-associated protein A
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
VAPA (VAMP associated protein A) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Vapa (vesicle-associated membrane protein, associated protein A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Vapa (VAMP associated protein A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
VAPA (VAMP associated protein A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
VAPA (VAMP associated protein A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Vapa (VAMP associated protein A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
VAPA (VAMP associated protein A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
VAPA (VAMP associated protein A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Vapa (VAMP associated protein A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Vapa (vesicle-associated membrane protein, associated protein A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
VAPA (VAMP associated protein A)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
vapal (VAMP (vesicle-associated membrane protein)-associated protein A, like)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
F42G2.5
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
SCS22
Alliance
DIOPT (InParanoid|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Vap33
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ZC196.2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
vpr-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
vapa
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 112,624,791 - 112,654,731 (-) NCBI GRCr8 mRatBN7.2 9 105,177,904 - 105,208,400 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 105,177,907 - 105,207,847 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 113,588,500 - 113,618,316 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 118,698,807 - 118,728,640 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 117,054,450 - 117,084,266 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 113,300,831 - 113,331,872 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 113,300,832 - 113,331,319 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 112,833,701 - 112,864,112 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 104,339,039 - 104,368,908 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 104,548,519 - 104,578,388 (-) NCBI Celera 9 102,564,697 - 102,594,412 (-) NCBI Celera Cytogenetic Map 9 q37 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Vapa Rat 1,2-dimethylhydrazine decreases expression ISO Vapa (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of VAPA mRNA CTD PMID:22206623 Vapa Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO VAPA (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Vapa Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Vapa (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of VAPA mRNA CTD PMID:21570461 Vapa Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of VAPA mRNA CTD PMID:34747641 Vapa Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO VAPA (Homo sapiens) 6480464 [Tetrachlorodibenzodioxin co-treated with 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide] results in decreased expression of VAPA mRNA CTD PMID:29704546 Vapa Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of VAPA mRNA CTD PMID:26232522 Vapa Rat 2,4,6-tribromophenol decreases expression ISO VAPA (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Vapa Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of VAPA mRNA CTD PMID:21346803 Vapa Rat 2,6-dimethoxyphenol multiple interactions ISO VAPA (Homo sapiens) 6480464 [pyrogallol 1 and 3-dimethyl ether co-treated with Furaldehyde] results in decreased expression of and affects the localization of VAPA protein CTD PMID:38598786 Vapa Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of VAPA mRNA CTD PMID:21346803 Vapa Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO VAPA (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of VAPA protein CTD PMID:31675489 Vapa Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO VAPA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of VAPA mRNA CTD PMID:28628672 Vapa Rat 4,4'-sulfonyldiphenol increases expression ISO Vapa (Mus musculus) 6480464 bisphenol S results in increased expression of VAPA mRNA CTD PMID:39298647 Vapa Rat 4,4'-sulfonyldiphenol increases expression ISO VAPA (Homo sapiens) 6480464 bisphenol S results in increased expression of VAPA protein CTD PMID:34186270 Vapa Rat 4,4'-sulfonyldiphenol multiple interactions ISO VAPA (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in decreased methylation of VAPA gene CTD PMID:31601247 Vapa Rat 4,4'-sulfonyldiphenol affects expression ISO VAPA (Homo sapiens) 6480464 bisphenol S affects the expression of VAPA protein CTD PMID:31945527 Vapa Rat acrolein multiple interactions ISO VAPA (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of VAPA mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of VAPA mRNA CTD PMID:32699268 Vapa Rat aflatoxin B1 increases methylation ISO VAPA (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of VAPA gene CTD PMID:27153756 Vapa Rat alpha-pinene multiple interactions ISO VAPA (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of VAPA mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of VAPA mRNA CTD PMID:32699268 Vapa Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of VAPA mRNA CTD PMID:16483693 Vapa Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of VAPA mRNA CTD PMID:30779732 Vapa Rat antirheumatic drug increases expression ISO VAPA (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of VAPA mRNA CTD PMID:24449571 Vapa Rat arsane affects methylation ISO VAPA (Homo sapiens) 6480464 Arsenic affects the methylation of VAPA gene CTD PMID:25304211 Vapa Rat arsane multiple interactions ISO VAPA (Homo sapiens) 6480464 [Palmitic Acid co-treated with Arsenic] affects the expression of VAPA mRNA CTD PMID:33736254 Vapa Rat arsenic atom affects methylation ISO VAPA (Homo sapiens) 6480464 Arsenic affects the methylation of VAPA gene CTD PMID:25304211 Vapa Rat arsenic atom multiple interactions ISO VAPA (Homo sapiens) 6480464 [Palmitic Acid co-treated with Arsenic] affects the expression of VAPA mRNA CTD PMID:33736254 Vapa Rat arsenite(3-) multiple interactions ISO VAPA (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to VAPA mRNA] and arsenite promotes the reaction [G3BP1 protein binds to VAPA protein] CTD PMID:32406909 Vapa Rat benzene increases expression ISO VAPA (Homo sapiens) 6480464 Benzene results in increased expression of VAPA mRNA CTD PMID:19162166 Vapa Rat benzo[a]pyrene increases expression ISO Vapa (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of VAPA mRNA CTD PMID:21569818 and PMID:22228805 Vapa Rat bisphenol A decreases expression ISO Vapa (Mus musculus) 6480464 bisphenol A results in decreased expression of VAPA mRNA CTD PMID:26512966 Vapa Rat bisphenol A increases expression ISO VAPA (Homo sapiens) 6480464 bisphenol A results in increased expression of VAPA protein CTD PMID:34186270 and PMID:37567409 Vapa Rat bisphenol A decreases expression ISO VAPA (Homo sapiens) 6480464 bisphenol A results in decreased expression of VAPA protein CTD PMID:31675489 Vapa Rat bisphenol A multiple interactions ISO VAPA (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of VAPA gene CTD PMID:31601247 Vapa Rat bisphenol A decreases methylation ISO VAPA (Homo sapiens) 6480464 bisphenol A results in decreased methylation of VAPA gene CTD PMID:31601247 Vapa Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of VAPA gene CTD PMID:28505145 Vapa Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of VAPA mRNA CTD PMID:25181051 and PMID:34947998 Vapa Rat bisphenol AF increases expression ISO VAPA (Homo sapiens) 6480464 bisphenol AF results in increased expression of VAPA protein CTD PMID:34186270 Vapa Rat bisphenol F multiple interactions ISO VAPA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of VAPA mRNA CTD PMID:28628672 Vapa Rat bisphenol F increases expression ISO VAPA (Homo sapiens) 6480464 bisphenol F results in increased expression of VAPA protein CTD PMID:34186270 Vapa Rat Brodifacoum decreases expression EXP 6480464 bromfenacoum results in decreased expression of VAPA protein CTD PMID:28903499 Vapa Rat cadmium dichloride decreases expression ISO VAPA (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of VAPA mRNA and Cadmium Chloride results in decreased expression of VAPA protein CTD PMID:25851441 Vapa Rat cadmium dichloride increases expression ISO VAPA (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of VAPA mRNA CTD PMID:38382870 Vapa Rat caffeine decreases phosphorylation ISO VAPA (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of VAPA protein CTD PMID:35688186 Vapa Rat cisplatin affects response to substance ISO VAPA (Homo sapiens) 6480464 VAPA protein affects the susceptibility to Cisplatin CTD PMID:16217747 Vapa Rat clozapine increases expression ISO VAPA (Homo sapiens) 6480464 Clozapine results in increased expression of VAPA protein CTD PMID:34122009 Vapa Rat coumarin affects phosphorylation ISO VAPA (Homo sapiens) 6480464 coumarin affects the phosphorylation of VAPA protein CTD PMID:35688186 Vapa Rat crocidolite asbestos decreases expression ISO Vapa (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of VAPA mRNA CTD PMID:29279043 Vapa Rat dexamethasone multiple interactions ISO VAPA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of VAPA mRNA CTD PMID:28628672 Vapa Rat Dibutyl phosphate affects expression ISO VAPA (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of VAPA mRNA CTD PMID:37042841 Vapa Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of VAPA mRNA CTD PMID:17379624 Vapa Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of VAPA mRNA CTD PMID:21551480 Vapa Rat dorsomorphin multiple interactions ISO VAPA (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Vapa Rat entinostat decreases expression ISO VAPA (Homo sapiens) 6480464 entinostat results in decreased expression of VAPA mRNA CTD PMID:26272509 Vapa Rat entinostat multiple interactions ISO VAPA (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of VAPA mRNA CTD PMID:27188386 Vapa Rat enzyme inhibitor multiple interactions ISO VAPA (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of VAPA protein CTD PMID:23301498 Vapa Rat epoxiconazole increases expression ISO Vapa (Mus musculus) 6480464 epoxiconazole results in increased expression of VAPA mRNA CTD PMID:35436446 Vapa Rat ethanol increases expression ISO Vapa (Mus musculus) 6480464 Ethanol results in increased expression of VAPA mRNA CTD PMID:30319688 Vapa Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of VAPA mRNA CTD PMID:24136188 Vapa Rat folic acid decreases expression ISO Vapa (Mus musculus) 6480464 Folic Acid results in decreased expression of VAPA mRNA CTD PMID:25629700 Vapa Rat FR900359 decreases phosphorylation ISO VAPA (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of VAPA protein CTD PMID:37730182 Vapa Rat fulvestrant multiple interactions ISO VAPA (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of VAPA gene and [bisphenol S co-treated with Fulvestrant] results in decreased methylation of VAPA gene CTD PMID:31601247 Vapa Rat fumonisin B1 increases expression ISO Vapa (Mus musculus) 6480464 fumonisin B1 results in increased expression of VAPA mRNA CTD PMID:16221962 Vapa Rat furfural multiple interactions ISO VAPA (Homo sapiens) 6480464 [pyrogallol 1 and 3-dimethyl ether co-treated with Furaldehyde] results in decreased expression of and affects the localization of VAPA protein CTD PMID:38598786 Vapa Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of VAPA mRNA CTD PMID:33387578 Vapa Rat glycidyl methacrylate increases expression ISO VAPA (Homo sapiens) 6480464 glycidyl methacrylate results in increased expression of VAPA protein CTD PMID:36641056 Vapa Rat hexadecanoic acid multiple interactions ISO VAPA (Homo sapiens) 6480464 [Palmitic Acid co-treated with Arsenic] affects the expression of VAPA mRNA CTD PMID:33736254 Vapa Rat hydroquinone decreases expression ISO VAPA (Homo sapiens) 6480464 hydroquinone results in decreased expression of VAPA mRNA CTD PMID:31256213 Vapa Rat indometacin multiple interactions ISO VAPA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of VAPA mRNA CTD PMID:28628672 Vapa Rat ivermectin decreases expression ISO VAPA (Homo sapiens) 6480464 Ivermectin results in decreased expression of VAPA protein CTD PMID:32959892 Vapa Rat lead diacetate decreases expression ISO Vapa (Mus musculus) 6480464 lead acetate results in decreased expression of VAPA mRNA CTD PMID:21829687 Vapa Rat methyl methanesulfonate decreases expression ISO VAPA (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of VAPA mRNA CTD PMID:23649840 Vapa Rat methylmercury chloride decreases expression ISO VAPA (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of VAPA mRNA CTD PMID:28001369 Vapa Rat ozone multiple interactions ISO VAPA (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of VAPA mRNA more ... CTD PMID:32699268 Vapa Rat panobinostat multiple interactions ISO VAPA (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of VAPA mRNA CTD PMID:27188386 Vapa Rat panobinostat decreases expression ISO VAPA (Homo sapiens) 6480464 panobinostat results in decreased expression of VAPA mRNA CTD PMID:26272509 Vapa Rat paracetamol affects expression ISO Vapa (Mus musculus) 6480464 Acetaminophen affects the expression of VAPA mRNA CTD PMID:17562736 Vapa Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of VAPA protein CTD PMID:24521700 Vapa Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of VAPA mRNA CTD PMID:16940010 Vapa Rat resveratrol increases expression ISO VAPA (Homo sapiens) 6480464 resveratrol results in increased expression of VAPA protein CTD PMID:18089832 Vapa Rat SB 431542 multiple interactions ISO VAPA (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Vapa Rat sunitinib increases expression ISO VAPA (Homo sapiens) 6480464 Sunitinib results in increased expression of VAPA mRNA CTD PMID:31533062 Vapa Rat tetrachloromethane increases expression ISO Vapa (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of VAPA mRNA CTD PMID:31919559 Vapa Rat triphenyl phosphate affects expression ISO VAPA (Homo sapiens) 6480464 triphenyl phosphate affects the expression of VAPA mRNA CTD PMID:37042841 Vapa Rat valproic acid decreases expression ISO VAPA (Homo sapiens) 6480464 Valproic Acid results in decreased expression of VAPA mRNA CTD PMID:23179753 and PMID:28001369
1,2-dimethylhydrazine (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) acrolein (ISO) aflatoxin B1 (ISO) alpha-pinene (ISO) ammonium chloride (EXP) amphetamine (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzene (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) Brodifacoum (EXP) cadmium dichloride (ISO) caffeine (ISO) cisplatin (ISO) clozapine (ISO) coumarin (ISO) crocidolite asbestos (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) diuron (EXP) dorsomorphin (ISO) entinostat (ISO) enzyme inhibitor (ISO) epoxiconazole (ISO) ethanol (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) fumonisin B1 (ISO) furfural (ISO) gentamycin (EXP) glycidyl methacrylate (ISO) hexadecanoic acid (ISO) hydroquinone (ISO) indometacin (ISO) ivermectin (ISO) lead diacetate (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) ozone (ISO) panobinostat (ISO) paracetamol (ISO) paraquat (EXP) pirinixic acid (EXP) resveratrol (ISO) SB 431542 (ISO) sunitinib (ISO) tetrachloromethane (ISO) triphenyl phosphate (ISO) valproic acid (ISO)
Cellular Component
anchoring junction (IEA) bicellular tight junction (IEA,ISO) endoplasmic reticulum (IEA,ISO,ISS) endoplasmic reticulum exit site (ISO) endoplasmic reticulum membrane (IBA,IDA,IEA,ISO) Golgi membrane (ISO) membrane (IDA,IEA) microtubule cytoskeleton (IEA,ISO) nuclear membrane (IDA,IEA) nucleus (IEA) perinuclear region of cytoplasm (ISO) plasma membrane (IBA,IEA,ISO) vesicle (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Structural basis of FFAT motif-mediated ER targeting.
Kaiser SE, etal., Structure. 2005 Jul;13(7):1035-45.
4.
Proteomic analysis of rat liver peroxisome: presence of peroxisome-specific isozyme of Lon protease.
Kikuchi M, etal., J Biol Chem. 2004 Jan 2;279(1):421-8. Epub 2003 Oct 15.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
Molecular cloning and characterization of mammalian homologues of vesicle-associated membrane protein-associated (VAMP-associated) proteins.
Nishimura Y, etal., Biochem Biophys Res Commun 1999 Jan 8;254(1):21-6.
8.
GOA pipeline
RGD automated data pipeline
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Promotion of neurite extension by protrudin requires its interaction with vesicle-associated membrane protein-associated protein.
Saita S, etal., J Biol Chem. 2009 May 15;284(20):13766-77. doi: 10.1074/jbc.M807938200. Epub 2009 Mar 16.
11.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
12.
Arl6IP1 has the ability to shape the mammalian ER membrane in a reticulon-like fashion.
Yamamoto Y, etal., Biochem J. 2014 Feb 15;458(1):69-79. doi: 10.1042/BJ20131186.
Vapa Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 112,624,791 - 112,654,731 (-) NCBI GRCr8 mRatBN7.2 9 105,177,904 - 105,208,400 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 105,177,907 - 105,207,847 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 113,588,500 - 113,618,316 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 118,698,807 - 118,728,640 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 117,054,450 - 117,084,266 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 113,300,831 - 113,331,872 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 113,300,832 - 113,331,319 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 112,833,701 - 112,864,112 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 104,339,039 - 104,368,908 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 104,548,519 - 104,578,388 (-) NCBI Celera 9 102,564,697 - 102,594,412 (-) NCBI Celera Cytogenetic Map 9 q37 NCBI
VAPA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 18 9,914,016 - 9,960,021 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 18 9,914,016 - 9,960,021 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 18 9,914,013 - 9,960,018 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 18 9,903,955 - 9,950,018 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 18 9,903,983 - 9,949,571 NCBI Celera 18 9,797,515 - 9,843,493 (+) NCBI Celera Cytogenetic Map 18 p11.22 NCBI HuRef 18 9,893,891 - 9,921,843 (+) NCBI HuRef CHM1_1 18 9,913,226 - 9,959,178 (+) NCBI CHM1_1 T2T-CHM13v2.0 18 10,077,467 - 10,123,397 (+) NCBI T2T-CHM13v2.0
Vapa Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 65,887,048 - 65,925,441 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 65,885,322 - 65,920,550 (-) Ensembl GRCm39 Ensembl GRCm38 17 65,580,053 - 65,616,462 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 65,578,327 - 65,613,555 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 65,929,393 - 65,962,895 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 65,479,598 - 65,513,084 (-) NCBI MGSCv36 mm8 Celera 17 69,883,322 - 69,916,704 (-) NCBI Celera Cytogenetic Map 17 E1.1 NCBI cM Map 17 34.9 NCBI
Vapa Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955402 2,270,850 - 2,298,227 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955402 2,274,248 - 2,309,461 (-) NCBI ChiLan1.0 ChiLan1.0
VAPA Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 17 28,496,390 - 28,537,484 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 18 14,188,987 - 14,230,079 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 18 4,329,479 - 4,373,047 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 18 6,613,042 - 6,642,425 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 18 6,612,105 - 6,637,829 (-) Ensembl panpan1.1 panPan2
VAPA Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 75,844,927 - 75,891,811 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 75,845,000 - 75,889,076 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 75,242,387 - 75,289,206 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 75,905,356 - 75,948,878 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 75,905,322 - 75,949,488 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 75,603,405 - 75,650,255 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 75,621,438 - 75,668,178 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 75,930,605 - 75,977,554 (+) NCBI UU_Cfam_GSD_1.0
Vapa Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404944 2,321,989 - 2,357,518 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936626 1,548,139 - 1,568,656 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936626 1,550,305 - 1,585,783 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
VAPA
VAPA Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 18 68,784,786 - 68,825,333 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 18 68,784,799 - 68,827,581 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 43,739,425 - 43,782,261 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Vapa
.
Predicted Target Of
Count of predictions: 526 Count of miRNA genes: 251 Interacting mature miRNAs: 307 Transcripts: ENSRNOT00000020681 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1354626 Bvd1 Brain ventricular dilatation QTL 1 3.73 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 9 75712843 111552878 Rat 7794784 Mcs31 Mammary carcinoma susceptibility QTL 31 2.98 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 9 77813894 111552878 Rat 731171 Glom6 Glomerulus QTL 6 2.8 0.0003 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 9 64573531 109573531 Rat 61385 Edpm9 Estrogen-dependent pituitary mass QTL 9 3.43 0.05 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 9 63869687 108869687 Rat 724544 Uae9 Urinary albumin excretion QTL 9 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 9 25268044 114175309 Rat
RH76596
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 105,177,948 - 105,178,119 (+) MAPPER mRatBN7.2 Rnor_6.0 9 113,300,876 - 113,301,046 NCBI Rnor6.0 Rnor_5.0 9 112,833,746 - 112,833,916 UniSTS Rnor5.0 RGSC_v3.4 9 104,339,084 - 104,339,254 UniSTS RGSC3.4 Celera 9 102,564,742 - 102,564,912 UniSTS Cytogenetic Map 9 q37 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020681 ⟹ ENSRNOP00000020681
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 105,177,907 - 105,207,847 (-) Ensembl Rnor_6.0 Ensembl 9 113,300,832 - 113,331,319 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000086340 ⟹ ENSRNOP00000074577
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 105,177,907 - 105,191,458 (-) Ensembl Rnor_6.0 Ensembl 9 113,301,256 - 113,328,428 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000113264 ⟹ ENSRNOP00000083505
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 105,177,907 - 105,207,847 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000117261 ⟹ ENSRNOP00000089269
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 105,177,907 - 105,204,749 (-) Ensembl
RefSeq Acc Id:
NM_031631 ⟹ NP_113819
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 112,624,791 - 112,654,731 (-) NCBI mRatBN7.2 9 105,177,904 - 105,207,847 (-) NCBI Rnor_6.0 9 113,300,831 - 113,331,319 (-) NCBI Rnor_5.0 9 112,833,701 - 112,864,112 (-) NCBI RGSC_v3.4 9 104,339,039 - 104,368,908 (-) RGD Celera 9 102,564,697 - 102,594,412 (-) RGD
Sequence:
CGCAGTGCGCGTGGCCGCGGCGACTGGTGTGGGGTTGAGTCAGTTGTGACACCCGGAGCTGCTGACCCGACAGGCAGCCCTCGGGACCCGCGGCCCGGCAGCAGGCGCGGAGCTTCGGGAATCGTGAG
hide sequence
RefSeq Acc Id:
XM_008767384 ⟹ XP_008765606
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 112,624,791 - 112,654,703 (-) NCBI mRatBN7.2 9 105,177,904 - 105,208,400 (-) NCBI Rnor_6.0 9 113,300,831 - 113,331,872 (-) NCBI
Sequence:
CCGTCTCTCCTGGGATGCCTGGCTCCCAGGCAGCCTGCAAAAACCCTTTTCTTTTTCCAATGCAGACGAGACAACCTCGGCGAGCCAAAAGCAGAGTCAGCGGCCCCACCCACTCGCCTCCAACGGAC
hide sequence
RefSeq Acc Id:
XM_039084144 ⟹ XP_038940072
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 112,624,791 - 112,654,703 (-) NCBI mRatBN7.2 9 105,177,904 - 105,207,808 (-) NCBI
RefSeq Acc Id:
XM_039084145 ⟹ XP_038940073
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 112,624,791 - 112,654,222 (-) NCBI mRatBN7.2 9 105,177,904 - 105,204,764 (-) NCBI
RefSeq Acc Id:
XM_063267660 ⟹ XP_063123730
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 112,624,791 - 112,651,838 (-) NCBI
RefSeq Acc Id:
NP_113819 ⟸ NM_031631
- UniProtKB:
Q6P723 (UniProtKB/Swiss-Prot), Q9Z270 (UniProtKB/Swiss-Prot), A6JRB7 (UniProtKB/TrEMBL), A0A0G2K8E6 (UniProtKB/TrEMBL)
- Sequence:
MASASGAMAKHEQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDELMDSKLRC
hide sequence
RefSeq Acc Id:
XP_008765606 ⟸ XM_008767384
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZVH7 (UniProtKB/TrEMBL), A6JRB8 (UniProtKB/TrEMBL), A0A0G2K8E6 (UniProtKB/TrEMBL)
- Sequence:
MASASGAMAKHEQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDELMDSKLRC
hide sequence
Ensembl Acc Id:
ENSRNOP00000020681 ⟸ ENSRNOT00000020681
Ensembl Acc Id:
ENSRNOP00000074577 ⟸ ENSRNOT00000086340
RefSeq Acc Id:
XP_038940072 ⟸ XM_039084144
- Peptide Label:
isoform X2
- UniProtKB:
A0A0G2K8E6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038940073 ⟸ XM_039084145
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6GHY4 (UniProtKB/TrEMBL), A0A0G2K8E6 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000083505 ⟸ ENSRNOT00000113264
Ensembl Acc Id:
ENSRNOP00000089269 ⟸ ENSRNOT00000117261
RefSeq Acc Id:
XP_063123730 ⟸ XM_063267660
- Peptide Label:
isoform X4
- UniProtKB:
A0A0G2K8E6 (UniProtKB/TrEMBL)
RGD ID: 13696902 Promoter ID: EPDNEW_R7426 Type: initiation region Name: Vapa_1 Description: VAMP associated protein A SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 9 113,331,278 - 113,331,338 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-07-11
Vapa
VAMP associated protein A
Vapa
VAMP (vesicle-associated membrane protein)-associated protein A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-12-15
Vapa
VAMP (vesicle-associated membrane protein)-associated protein A
Vapa
vesicle-associated membrane protein, associated protein a
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Vapa
vesicle-associated membrane protein, associated protein a
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_domains
contains coiled-coil, t-SNARE homology domain near the carboxyl-terminal
61779
gene_expression
ubiquitously expressed
61779
