Symbol:
Hspa13
Name:
heat shock protein family A (Hsp70) member 13
RGD ID:
3775
Description:
Predicted to enable ATP hydrolysis activity; heat shock protein binding activity; and protein folding chaperone. Predicted to be involved in chaperone cofactor-dependent protein refolding and protein refolding. Predicted to be located in endoplasmic reticulum. Predicted to be active in cytosol; nucleus; and plasma membrane. Orthologous to human HSPA13 (heat shock protein family A (Hsp70) member 13); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3H-1,2-dithiole-3-thione.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
heat shock 70 kDa protein 13; heat shock protein 13; heat shock protein 70 family, member 13; heat shock protein 70kDa family, member 13; microsomal stress 70 protein ATPase core; microsomal stress-70 protein ATPase core; Stch; stress 70 protein chaperone microsome-associated 60 kDa protein; stress 70 protein chaperone microsome-associated 60kD human homolog; stress 70 protein chaperone, microsome-associated; stress 70 protein chaperone, microsome-associated, 60kD human homolog; stress 70 protein chaperone, microsome-associated, human homolog; stress-70 protein chaperone microsome-associated 60 kDa protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 27,862,717 - 27,876,898 (-) NCBI GRCr8 mRatBN7.2 11 14,375,669 - 14,389,853 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 14,373,275 - 14,389,895 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 23,001,434 - 23,015,613 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 15,727,804 - 15,741,983 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 14,895,675 - 14,909,854 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 14,146,515 - 14,160,697 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 14,144,130 - 14,160,892 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 17,802,649 - 17,816,830 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 14,521,734 - 14,535,915 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 14,521,609 - 14,535,915 (-) NCBI Celera 11 14,388,645 - 14,402,826 (-) NCBI Celera Cytogenetic Map 11 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hspa13 Rat 1,2-dimethylhydrazine increases expression ISO Hspa13 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of HSPA13 mRNA CTD PMID:22206623 Hspa13 Rat 17beta-estradiol increases expression ISO HSPA13 (Homo sapiens) 6480464 Estradiol results in increased expression of HSPA13 mRNA CTD PMID:20106945 more ... Hspa13 Rat 17beta-estradiol increases expression ISO Hspa13 (Mus musculus) 6480464 Estradiol results in increased expression of HSPA13 mRNA CTD PMID:39298647 Hspa13 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of HSPA13 mRNA CTD PMID:26496021 Hspa13 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO HSPA13 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of HSPA13 mRNA CTD PMID:29581250 Hspa13 Rat 1H-pyrazole increases expression ISO Hspa13 (Mus musculus) 6480464 pyrazole results in increased expression of HSPA13 mRNA CTD PMID:17945193 Hspa13 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO HSPA13 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of HSPA13 mRNA CTD PMID:22298810 Hspa13 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of HSPA13 mRNA CTD PMID:32109520 Hspa13 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO HSPA13 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of HSPA13 mRNA CTD PMID:20106945 and PMID:21632981 Hspa13 Rat 2,4,6-tribromophenol decreases expression ISO HSPA13 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Hspa13 Rat 2-hydroxypropanoic acid decreases expression ISO HSPA13 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of HSPA13 mRNA CTD PMID:30851411 Hspa13 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO HSPA13 (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of HSPA13 protein CTD PMID:31675489 Hspa13 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Hspa13 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of HSPA13 mRNA CTD PMID:20188158 Hspa13 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of HSPA13 mRNA CTD PMID:19162173 Hspa13 Rat 4,4'-sulfonyldiphenol increases expression ISO Hspa13 (Mus musculus) 6480464 bisphenol S results in increased expression of HSPA13 mRNA CTD PMID:39298647 Hspa13 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of HSPA13 mRNA CTD PMID:31881176 Hspa13 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of HSPA13 mRNA CTD PMID:28959563 Hspa13 Rat aflatoxin B1 affects expression ISO HSPA13 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of HSPA13 protein CTD PMID:20106945 Hspa13 Rat aldehydo-D-glucose decreases expression ISO Hspa13 (Mus musculus) 6480464 Glucose results in decreased expression of HSPA13 mRNA CTD PMID:17178593 Hspa13 Rat all-trans-retinoic acid decreases expression ISO HSPA13 (Homo sapiens) 6480464 Tretinoin results in decreased expression of HSPA13 mRNA CTD PMID:33167477 Hspa13 Rat aristolochic acid A decreases expression ISO HSPA13 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of HSPA13 mRNA CTD PMID:33212167 Hspa13 Rat arsane multiple interactions ISO HSPA13 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of HSPA13 mRNA CTD PMID:39836092 Hspa13 Rat arsane affects expression ISO HSPA13 (Homo sapiens) 6480464 Arsenic affects the expression of HSPA13 mRNA CTD PMID:18414638 Hspa13 Rat arsenic atom multiple interactions ISO HSPA13 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of HSPA13 mRNA CTD PMID:39836092 Hspa13 Rat arsenic atom affects expression ISO HSPA13 (Homo sapiens) 6480464 Arsenic affects the expression of HSPA13 mRNA CTD PMID:18414638 Hspa13 Rat arsenite(3-) multiple interactions ISO HSPA13 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to HSPA13 mRNA] CTD PMID:32406909 Hspa13 Rat benzo[a]pyrene increases expression ISO HSPA13 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of HSPA13 mRNA CTD PMID:17879257 Hspa13 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO HSPA13 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in decreased methylation of HSPA13 5' UTR CTD PMID:33872906 Hspa13 Rat bis(2-ethylhexyl) phthalate increases expression ISO Hspa13 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of HSPA13 mRNA CTD PMID:35550907 Hspa13 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of HSPA13 mRNA CTD PMID:26496021 Hspa13 Rat bisphenol A decreases expression ISO HSPA13 (Homo sapiens) 6480464 bisphenol A results in decreased expression of HSPA13 protein CTD PMID:31675489 Hspa13 Rat bisphenol A increases expression ISO HSPA13 (Homo sapiens) 6480464 bisphenol A analog results in increased expression of HSPA13 mRNA and bisphenol A results in increased expression of HSPA13 mRNA CTD PMID:32387340 Hspa13 Rat bisphenol A affects expression ISO HSPA13 (Homo sapiens) 6480464 bisphenol A affects the expression of HSPA13 mRNA CTD PMID:30903817 Hspa13 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of HSPA13 mRNA CTD PMID:25181051 and PMID:32145629 Hspa13 Rat Bisphenol B increases expression ISO HSPA13 (Homo sapiens) 6480464 bisphenol B results in increased expression of HSPA13 mRNA CTD PMID:32387340 Hspa13 Rat bisphenol F increases expression ISO Hspa13 (Mus musculus) 6480464 bisphenol F results in increased expression of HSPA13 mRNA CTD PMID:38685157 Hspa13 Rat Bisphenol Z increases expression ISO HSPA13 (Homo sapiens) 6480464 bisphenol Z results in increased expression of HSPA13 mRNA CTD PMID:32387340 Hspa13 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of HSPA13 mRNA CTD PMID:24136188 Hspa13 Rat butyric acid increases expression EXP 6480464 Butyric Acid results in increased expression of HSPA13 mRNA CTD PMID:12800193 Hspa13 Rat cadmium atom multiple interactions ISO HSPA13 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of HSPA13 mRNA CTD PMID:35301059 Hspa13 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of HSPA13 promoter CTD PMID:22457795 Hspa13 Rat cadmium dichloride multiple interactions ISO HSPA13 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of HSPA13 mRNA CTD PMID:35301059 Hspa13 Rat cannabidiol decreases expression ISO HSPA13 (Homo sapiens) 6480464 Cannabidiol results in decreased expression of HSPA13 mRNA CTD PMID:27714895 Hspa13 Rat carbon nanotube increases expression ISO Hspa13 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Hspa13 Rat celastrol increases expression ISO HSPA13 (Homo sapiens) 6480464 celastrol results in increased expression of HSPA13 mRNA CTD PMID:17010675 Hspa13 Rat cobalt dichloride increases expression ISO HSPA13 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of HSPA13 mRNA CTD PMID:19376846 Hspa13 Rat copper atom multiple interactions ISO HSPA13 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of HSPA13 mRNA CTD PMID:20971185 Hspa13 Rat copper(0) multiple interactions ISO HSPA13 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of HSPA13 mRNA CTD PMID:20971185 Hspa13 Rat corosolic acid increases expression ISO HSPA13 (Homo sapiens) 6480464 corosolic acid results in increased expression of HSPA13 mRNA CTD PMID:37939859 Hspa13 Rat CU-O LINKAGE increases expression ISO HSPA13 (Homo sapiens) 6480464 cupric oxide results in increased expression of HSPA13 mRNA CTD PMID:22077320 Hspa13 Rat cyclosporin A increases expression ISO HSPA13 (Homo sapiens) 6480464 Cyclosporine results in increased expression of HSPA13 mRNA CTD PMID:20106945 more ... Hspa13 Rat cyproconazole increases expression ISO Hspa13 (Mus musculus) 6480464 cyproconazole results in increased expression of HSPA13 mRNA CTD PMID:22334560 Hspa13 Rat D-glucose decreases expression ISO Hspa13 (Mus musculus) 6480464 Glucose results in decreased expression of HSPA13 mRNA CTD PMID:17178593 Hspa13 Rat DDE decreases expression ISO HSPA13 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of HSPA13 mRNA CTD PMID:38568856 Hspa13 Rat dicrotophos decreases expression ISO HSPA13 (Homo sapiens) 6480464 dicrotophos results in decreased expression of HSPA13 mRNA CTD PMID:28302478 Hspa13 Rat dimethylarsinous acid increases expression ISO HSPA13 (Homo sapiens) 6480464 dimethylarsinous acid results in increased expression of HSPA13 mRNA CTD PMID:23487506 Hspa13 Rat diuron decreases expression ISO HSPA13 (Homo sapiens) 6480464 Diuron results in decreased expression of HSPA13 mRNA CTD PMID:35967413 Hspa13 Rat doxorubicin decreases expression ISO HSPA13 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of HSPA13 mRNA CTD PMID:29803840 Hspa13 Rat epoxiconazole increases expression ISO Hspa13 (Mus musculus) 6480464 epoxiconazole results in increased expression of HSPA13 mRNA CTD PMID:22334560 Hspa13 Rat fenofibrate decreases expression ISO Hspa13 (Mus musculus) 6480464 Fenofibrate results in decreased expression of HSPA13 mRNA CTD PMID:21318169 Hspa13 Rat fenofibrate multiple interactions ISO Hspa13 (Mus musculus) 6480464 PPARA protein affects the reaction [Fenofibrate results in decreased expression of HSPA13 mRNA] CTD PMID:21318169 Hspa13 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of HSPA13 mRNA CTD PMID:18035473 Hspa13 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of HSPA13 mRNA CTD PMID:24136188 Hspa13 Rat formaldehyde increases expression ISO HSPA13 (Homo sapiens) 6480464 Formaldehyde results in increased expression of HSPA13 mRNA CTD PMID:27664576 Hspa13 Rat gedunin increases expression ISO HSPA13 (Homo sapiens) 6480464 gedunin results in increased expression of HSPA13 mRNA CTD PMID:17010675 Hspa13 Rat genistein decreases expression ISO Hspa13 (Mus musculus) 6480464 Genistein results in decreased expression of HSPA13 mRNA CTD PMID:24967385 Hspa13 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of HSPA13 mRNA CTD PMID:24136188 Hspa13 Rat glucose decreases expression ISO Hspa13 (Mus musculus) 6480464 Glucose results in decreased expression of HSPA13 mRNA CTD PMID:17178593 Hspa13 Rat glycidyl methacrylate increases expression ISO HSPA13 (Homo sapiens) 6480464 glycidyl methacrylate results in increased expression of HSPA13 protein CTD PMID:36641056 Hspa13 Rat gold atom decreases expression ISO HSPA13 (Homo sapiens) 6480464 Gold results in decreased expression of HSPA13 mRNA CTD PMID:25523186 Hspa13 Rat gold(0) decreases expression ISO HSPA13 (Homo sapiens) 6480464 Gold results in decreased expression of HSPA13 mRNA CTD PMID:25523186 Hspa13 Rat hydrogen peroxide decreases expression ISO HSPA13 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of HSPA13 mRNA CTD PMID:12419474 Hspa13 Rat hydroquinone increases expression ISO HSPA13 (Homo sapiens) 6480464 hydroquinone results in increased expression of HSPA13 mRNA CTD PMID:31256213 Hspa13 Rat hypochlorous acid increases expression ISO Hspa13 (Mus musculus) 6480464 Hypochlorous Acid results in increased expression of HSPA13 mRNA CTD PMID:19376150 Hspa13 Rat ivermectin decreases expression ISO HSPA13 (Homo sapiens) 6480464 Ivermectin results in decreased expression of HSPA13 protein CTD PMID:32959892 Hspa13 Rat manganese atom multiple interactions ISO HSPA13 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of HSPA13 mRNA CTD PMID:39836092 Hspa13 Rat manganese(0) multiple interactions ISO HSPA13 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of HSPA13 mRNA CTD PMID:39836092 Hspa13 Rat manganese(II) chloride multiple interactions ISO HSPA13 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of HSPA13 mRNA CTD PMID:39836092 Hspa13 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of HSPA13 mRNA CTD PMID:30467583 Hspa13 Rat methylmercury chloride decreases expression ISO HSPA13 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of HSPA13 mRNA CTD PMID:28001369 Hspa13 Rat methylparaben increases expression ISO HSPA13 (Homo sapiens) 6480464 methylparaben results in increased expression of HSPA13 mRNA CTD PMID:38568856 Hspa13 Rat mifepristone increases expression ISO HSPA13 (Homo sapiens) 6480464 Mifepristone results in increased expression of HSPA13 mRNA CTD PMID:17584828 Hspa13 Rat mono(2-ethylhexyl) phthalate decreases expression ISO HSPA13 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of HSPA13 mRNA CTD PMID:38685446 Hspa13 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO HSPA13 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in decreased methylation of HSPA13 5' UTR CTD PMID:33872906 Hspa13 Rat nickel atom increases expression ISO HSPA13 (Homo sapiens) 6480464 Nickel results in increased expression of HSPA13 mRNA CTD PMID:24768652 and PMID:25583101 Hspa13 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of HSPA13 mRNA CTD PMID:24136188 Hspa13 Rat paracetamol increases expression ISO HSPA13 (Homo sapiens) 6480464 Acetaminophen results in increased expression of HSPA13 mRNA CTD PMID:21420995 and PMID:29067470 Hspa13 Rat paracetamol decreases expression ISO Hspa13 (Mus musculus) 6480464 Acetaminophen results in decreased expression of HSPA13 mRNA CTD PMID:29246445 Hspa13 Rat paracetamol multiple interactions ISO Hspa13 (Mus musculus) 6480464 PANX1 gene mutant form inhibits the reaction [Acetaminophen results in increased expression of HSPA13 mRNA] CTD PMID:29246445 Hspa13 Rat perfluorononanoic acid increases expression ISO HSPA13 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in increased expression of HSPA13 mRNA CTD PMID:32588087 Hspa13 Rat phenobarbital affects expression ISO Hspa13 (Mus musculus) 6480464 Phenobarbital affects the expression of HSPA13 mRNA CTD PMID:23091169 Hspa13 Rat phenobarbital increases expression ISO Hspa13 (Mus musculus) 6480464 Phenobarbital results in increased expression of HSPA13 mRNA CTD PMID:19363144 Hspa13 Rat phenobarbital affects expression ISO HSPA13 (Homo sapiens) 6480464 Phenobarbital affects the expression of HSPA13 mRNA CTD PMID:19159669 Hspa13 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of HSPA13 mRNA CTD PMID:19162173 Hspa13 Rat phlorizin decreases expression ISO Hspa13 (Mus musculus) 6480464 Phlorhizin results in decreased expression of HSPA13 mRNA CTD PMID:22538082 Hspa13 Rat picoxystrobin increases expression ISO HSPA13 (Homo sapiens) 6480464 picoxystrobin results in increased expression of HSPA13 mRNA CTD PMID:33512557 Hspa13 Rat pirinixic acid decreases expression ISO Hspa13 (Mus musculus) 6480464 pirinixic acid results in decreased expression of HSPA13 mRNA CTD PMID:21318169 and PMID:23811191 Hspa13 Rat pirinixic acid multiple interactions ISO Hspa13 (Mus musculus) 6480464 PPARA protein affects the reaction [pirinixic acid results in decreased expression of HSPA13 mRNA] CTD PMID:21318169 Hspa13 Rat potassium dichromate increases expression ISO Hspa13 (Mus musculus) 6480464 Potassium Dichromate results in increased expression of HSPA13 mRNA CTD PMID:23608068 Hspa13 Rat propiconazole increases expression ISO Hspa13 (Mus musculus) 6480464 propiconazole results in increased expression of HSPA13 mRNA CTD PMID:19363144 more ... Hspa13 Rat rac-lactic acid decreases expression ISO HSPA13 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of HSPA13 mRNA CTD PMID:30851411 Hspa13 Rat silicon dioxide increases expression ISO Hspa13 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of HSPA13 mRNA CTD PMID:23221170 Hspa13 Rat sodium arsenate increases expression ISO Hspa13 (Mus musculus) 6480464 sodium arsenate results in increased expression of HSPA13 mRNA CTD PMID:30953684 Hspa13 Rat sodium arsenite increases expression ISO HSPA13 (Homo sapiens) 6480464 sodium arsenite results in increased expression of HSPA13 mRNA CTD PMID:38568856 Hspa13 Rat sodium arsenite multiple interactions ISO HSPA13 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of HSPA13 mRNA CTD PMID:39836092 Hspa13 Rat sulforaphane increases expression ISO HSPA13 (Homo sapiens) 6480464 sulforaphane results in increased expression of HSPA13 mRNA CTD PMID:31838189 Hspa13 Rat sunitinib increases expression ISO HSPA13 (Homo sapiens) 6480464 Sunitinib results in increased expression of HSPA13 mRNA CTD PMID:31533062 Hspa13 Rat tamoxifen increases expression ISO HSPA13 (Homo sapiens) 6480464 Tamoxifen results in increased expression of HSPA13 mRNA CTD PMID:15590111 Hspa13 Rat tert-butyl hydroperoxide decreases expression ISO HSPA13 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of HSPA13 mRNA CTD PMID:12419474 Hspa13 Rat tetrachloromethane increases expression ISO Hspa13 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of HSPA13 mRNA CTD PMID:27339419 and PMID:31919559 Hspa13 Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of HSPA13 mRNA CTD PMID:15963342 Hspa13 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of HSPA13 mRNA CTD PMID:31150632 Hspa13 Rat thimerosal increases expression ISO HSPA13 (Homo sapiens) 6480464 Thimerosal results in increased expression of HSPA13 mRNA CTD PMID:27188386 Hspa13 Rat titanium dioxide decreases methylation ISO Hspa13 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of HSPA13 gene CTD PMID:35295148 Hspa13 Rat triadimefon increases expression ISO Hspa13 (Mus musculus) 6480464 triadimefon results in increased expression of HSPA13 mRNA CTD PMID:19363144 Hspa13 Rat trichostatin A decreases expression ISO HSPA13 (Homo sapiens) 6480464 trichostatin A results in decreased expression of HSPA13 mRNA CTD PMID:24935251 Hspa13 Rat triphenyl phosphate affects expression ISO HSPA13 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of HSPA13 mRNA CTD PMID:37042841 Hspa13 Rat tunicamycin increases expression ISO HSPA13 (Homo sapiens) 6480464 Tunicamycin results in increased expression of HSPA13 mRNA CTD PMID:38498338 Hspa13 Rat tunicamycin increases expression ISO Hspa13 (Mus musculus) 6480464 Tunicamycin results in increased expression of HSPA13 mRNA CTD PMID:17127020 Hspa13 Rat urethane increases expression ISO HSPA13 (Homo sapiens) 6480464 Urethane results in increased expression of HSPA13 mRNA CTD PMID:28818685 Hspa13 Rat valproic acid increases expression ISO HSPA13 (Homo sapiens) 6480464 Valproic Acid results in increased expression of HSPA13 mRNA CTD PMID:29154799 Hspa13 Rat valproic acid decreases expression ISO HSPA13 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of HSPA13 mRNA CTD PMID:23179753
1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 1H-pyrazole (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2-hydroxypropanoic acid (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (ISO) Bisphenol Z (ISO) buspirone (EXP) butyric acid (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) cannabidiol (ISO) carbon nanotube (ISO) celastrol (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) corosolic acid (ISO) CU-O LINKAGE (ISO) cyclosporin A (ISO) cyproconazole (ISO) D-glucose (ISO) DDE (ISO) dicrotophos (ISO) dimethylarsinous acid (ISO) diuron (ISO) doxorubicin (ISO) epoxiconazole (ISO) fenofibrate (ISO) flavonoids (EXP) flutamide (EXP) formaldehyde (ISO) gedunin (ISO) genistein (ISO) glafenine (EXP) glucose (ISO) glycidyl methacrylate (ISO) gold atom (ISO) gold(0) (ISO) hydrogen peroxide (ISO) hydroquinone (ISO) hypochlorous acid (ISO) ivermectin (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (EXP) methylmercury chloride (ISO) methylparaben (ISO) mifepristone (ISO) mono(2-ethylhexyl) phthalate (ISO) nickel atom (ISO) nimesulide (EXP) paracetamol (ISO) perfluorononanoic acid (ISO) phenobarbital (EXP,ISO) phlorizin (ISO) picoxystrobin (ISO) pirinixic acid (ISO) potassium dichromate (ISO) propiconazole (ISO) rac-lactic acid (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sulforaphane (ISO) sunitinib (ISO) tamoxifen (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP,ISO) thimerosal (ISO) titanium dioxide (ISO) triadimefon (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.
A 'core ATPase', Hsp70-like structure is conserved in human, rat, and C. elegans STCH proteins.
Otterson GA and Kaye FJ, Gene 1997 Oct 15;199(1-2):287-92.
6.
Stch encodes the 'ATPase core' of a microsomal stress 70 protein.
Otterson GA, etal., EMBO J 1994 Mar 1;13(5):1216-25.
7.
GOA pipeline
RGD automated data pipeline
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
11.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
Hspa13 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 27,862,717 - 27,876,898 (-) NCBI GRCr8 mRatBN7.2 11 14,375,669 - 14,389,853 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 14,373,275 - 14,389,895 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 23,001,434 - 23,015,613 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 15,727,804 - 15,741,983 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 14,895,675 - 14,909,854 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 14,146,515 - 14,160,697 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 14,144,130 - 14,160,892 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 17,802,649 - 17,816,830 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 14,521,734 - 14,535,915 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 14,521,609 - 14,535,915 (-) NCBI Celera 11 14,388,645 - 14,402,826 (-) NCBI Celera Cytogenetic Map 11 p11 NCBI
HSPA13 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 21 14,371,115 - 14,383,146 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 21 14,371,115 - 14,383,484 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 21 15,743,436 - 15,755,467 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 21 14,665,307 - 14,677,380 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 21 14,665,309 - 14,677,380 NCBI Celera 21 900,677 - 912,750 (-) NCBI Celera Cytogenetic Map 21 q11.2 NCBI HuRef 21 1,113,800 - 1,125,871 (-) NCBI HuRef CHM1_1 21 15,303,921 - 15,315,993 (-) NCBI CHM1_1 T2T-CHM13v2.0 21 12,713,857 - 12,725,888 (-) NCBI T2T-CHM13v2.0
Hspa13 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 75,552,078 - 75,564,575 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 75,542,319 - 75,563,992 (-) Ensembl GRCm39 Ensembl GRCm38 16 75,755,190 - 75,767,276 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 75,745,431 - 75,767,104 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 75,755,435 - 75,767,063 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 75,637,874 - 75,649,458 (-) NCBI MGSCv36 mm8 Celera 16 75,974,819 - 75,986,466 (-) NCBI Celera Cytogenetic Map 16 C3.1 NCBI cM Map 16 43.36 NCBI
Hspa13 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955407 16,195,308 - 16,206,100 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955407 16,195,366 - 16,205,371 (-) NCBI ChiLan1.0 ChiLan1.0
HSPA13 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 22 10,852,296 - 10,864,421 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 21 5,686,034 - 5,698,158 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 21 1,101,715 - 1,113,865 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 21 14,468,887 - 14,480,986 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 21 14,468,887 - 14,480,986 (-) Ensembl panpan1.1 panPan2
HSPA13 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 31 11,365,374 - 11,377,896 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 31 11,367,788 - 11,377,828 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 31 11,376,570 - 11,389,273 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 31 11,390,307 - 11,403,009 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 31 11,389,844 - 11,402,716 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 31 11,363,132 - 11,375,866 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 31 11,400,638 - 11,413,475 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 31 11,797,157 - 11,809,886 (-) NCBI UU_Cfam_GSD_1.0
Hspa13 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404971 12,476,191 - 12,486,942 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936505 7,394,075 - 7,406,692 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936505 7,395,962 - 7,406,662 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HSPA13 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 179,310,727 - 179,321,491 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 179,309,746 - 179,321,297 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 189,549,394 - 189,560,925 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HSPA13 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 78,136,291 - 78,148,457 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 78,136,170 - 78,148,991 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 75,771,695 - 75,783,945 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hspa13
.
Predicted Target Of
Count of predictions: 63 Count of miRNA genes: 50 Interacting mature miRNAs: 59 Transcripts: ENSRNOT00000047320 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300147 Bp187 Blood pressure QTL 187 3.67 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 11 1 69446234 Rat 2290451 Scl58 Serum cholesterol level QTL 58 3.48 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 11 12831046 25121472 Rat 1598842 Glom10 Glomerulus QTL 10 3.4 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 11 1 35331169 Rat 1558659 Tescar1 Testicular tumor resistance QTL 1 3.9 testis integrity trait (VT:0010572) percentage of study population developing testis tumors during a period of time (CMO:0001261) 11 1041931 66113562 Rat 634341 Bw121 Body weight QTL 121 3.56 abdominal fat pad mass (VT:1000711) abdominal fat pad weight (CMO:0000088) 11 1 21836709 Rat 1641927 Alcrsp10 Alcohol response QTL 10 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 11 8436674 53436674 Rat
RH142228
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 14,375,679 - 14,375,856 (+) MAPPER mRatBN7.2 Rnor_6.0 11 14,146,526 - 14,146,702 NCBI Rnor6.0 Rnor_5.0 11 17,802,660 - 17,802,836 UniSTS Rnor5.0 RGSC_v3.4 11 14,521,745 - 14,521,921 UniSTS RGSC3.4 Celera 11 14,388,656 - 14,388,832 UniSTS Cytogenetic Map 11 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000081096 ⟹ ENSRNOP00000070174
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 14,376,769 - 14,389,895 (-) Ensembl Rnor_6.0 Ensembl 11 14,146,521 - 14,160,697 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000091864 ⟹ ENSRNOP00000071352
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 11 14,144,130 - 14,160,892 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000102472 ⟹ ENSRNOP00000096623
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 14,373,275 - 14,388,733 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000109029 ⟹ ENSRNOP00000095281
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 14,373,275 - 14,389,893 (-) Ensembl
RefSeq Acc Id:
NM_019271 ⟹ NP_062144
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 27,862,717 - 27,876,898 (-) NCBI mRatBN7.2 11 14,375,669 - 14,389,853 (-) NCBI Rnor_6.0 11 14,146,515 - 14,160,697 (-) NCBI Rnor_5.0 11 17,802,649 - 17,816,830 (-) NCBI RGSC_v3.4 11 14,521,734 - 14,535,915 (-) RGD Celera 11 14,388,645 - 14,402,826 (-) RGD
Sequence:
CTGATGGCCGGAGAGATGACGATCTTAGGTTCCGCTGTCTTGACTCTCCTGTTGGCTGGCTACTTGGCACAACAGTATTTACCACTGCCAACTCCAAAAGTGATTGGCATTGACCTGGGTACCACCTA
hide sequence
RefSeq Acc Id:
NP_062144 ⟸ NM_019271
- Peptide Label:
precursor
- UniProtKB:
Q6IRE1 (UniProtKB/Swiss-Prot), O35162 (UniProtKB/Swiss-Prot), A6JL16 (UniProtKB/TrEMBL), A0A8I6GM59 (UniProtKB/TrEMBL)
- Sequence:
MAGEMTILGSAVLTLLLAGYLAQQYLPLPTPKVIGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDGDVYVGYESLELADSNPQNTIYDAKRFIGKIFTPEELEAEIGRYPFKVLHKNG
hide sequence
Ensembl Acc Id:
ENSRNOP00000070174 ⟸ ENSRNOT00000081096
Ensembl Acc Id:
ENSRNOP00000071352 ⟸ ENSRNOT00000091864
Ensembl Acc Id:
ENSRNOP00000096623 ⟸ ENSRNOT00000102472
Ensembl Acc Id:
ENSRNOP00000095281 ⟸ ENSRNOT00000109029
RGD ID: 13698004 Promoter ID: EPDNEW_R8529 Type: multiple initiation site Name: Hspa13_1 Description: heat shock protein family A member 13 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 11 14,160,720 - 14,160,780 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-07-05
Hspa13
heat shock protein family A (Hsp70) member 13
Hspa13
heat shock protein 70 family, member 13
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-06-04
Hspa13
heat shock protein 70 family, member 13
Hspa13
heat shock protein 13
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2011-04-29
Hspa13
heat shock protein 13
Hspa13
heat shock protein 70 family, member 13
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2011-04-27
Hspa13
heat shock protein 70 family, member 13
Hspa13
heat shock protein 70kDa family, member 13
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-11-20
Hspa13
heat shock protein 70kDa family, member 13
Stch
stress 70 protein chaperone, microsome-associated, human homolog
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-05-15
Stch
stress 70 protein chaperone, microsome-associated, human homolog
Stch
stress 70 protein chaperone, microsome-associated
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-15
Stch
stress 70 protein chaperone, microsome-associated
Stch
stress 70 protein chaperone, microsome-associated, 60kD human homolog
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Stch
stress 70 protein chaperone, microsome-associated, 60kD human homolog
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_domains
novel microsome-associated protein member of the stress70 protein chaperone family
634153
gene_process
brings about cellular responses to protein processing requirements
634153
gene_protein
protein has a membrane-bound microsome fraction
634153
