Advanced Search (OLGA)

Gene: Madcam1 (mucosal vascular addressin cell adhesion molecule 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Madcam1

Name:

mucosal vascular addressin cell adhesion molecule 1

RGD ID:

3029

Description:

Predicted to enable integrin binding activity involved in cell-matrix adhesion. Involved in cell adhesion and positive regulation of leukocyte migration. Predicted to be located in plasma membrane. Used to study Crohn's disease and food allergy. Orthologous to human MADCAM1 (mucosal vascular addressin cell adhesion molecule 1); INTERACTS WITH 1,2-dimethylhydrazine; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MAdCAM-1; mucosal addressin cell adhesion molecule 1; rMAdCAM-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	10,686,920 - 10,690,322 (-)	NCBI		GRCr8
mRatBN7.2	7	10,036,301 - 10,039,703 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	10,036,301 - 10,039,703 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	12,917,270 - 12,920,672 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	14,795,349 - 14,798,751 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	12,654,653 - 12,658,055 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	12,918,352 - 12,922,509 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	12,918,710 - 12,922,112 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	13,087,337 - 13,092,220 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	11,553,219 - 11,556,621 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	11,553,218 - 11,556,621 (-)	NCBI
Celera	7	8,209,542 - 8,212,944 (-)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Madcam1	Rat	Crohn's disease		IMP		2311550		RGD
Madcam1	Rat	food allergy		IMP		2311549		RGD
Madcam1	Rat	type 1 diabetes mellitus		ISO	Madcam1 (Mus musculus)	2311545		RGD
Madcam1	Rat	type 1 diabetes mellitus		ISO	Madcam1 (Mus musculus)	2311544		RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Madcam1	Rat	colitis		ISO	MADCAM1 (Homo sapiens)	11554173	CTD Direct Evidence: therapeutic	CTD	PMID:16917232
Madcam1	Rat	ovarian cyst		ISO	MADCAM1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:21239663

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Madcam1	Rat	1,2-dimethylhydrazine	multiple interactions	EXP		6480464	[APC protein affects the susceptibility to 1 and 2-Dimethylhydrazine] which results in increased expression of MADCAM1 mRNA	CTD	PMID:27840820
Madcam1	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Madcam1 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of MADCAM1 mRNA	CTD	PMID:22206623
Madcam1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Madcam1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of MADCAM1 mRNA	CTD	PMID:21570461
Madcam1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of MADCAM1 mRNA	CTD	PMID:32109520
Madcam1	Rat	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	EXP		6480464	2 more ...	CTD	PMID:32109520
Madcam1	Rat	2,4,6-trinitrobenzenesulfonic acid	multiple interactions	ISO	Madcam1 (Mus musculus)	6480464	Curcumin inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of MADCAM1 mRNA]	CTD	PMID:18200517
Madcam1	Rat	2,4,6-trinitrobenzenesulfonic acid	increases expression	ISO	Madcam1 (Mus musculus)	6480464	Trinitrobenzenesulfonic Acid results in increased expression of MADCAM1 mRNA	CTD	PMID:18200517
Madcam1	Rat	2-butan-2-yl-4-[4-[4-[4-[[2-(2,4-dichlorophenyl)-2-(1,2,4-triazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy]phenyl]-1-piperazinyl]phenyl]-1,2,4-triazol-3-one	multiple interactions	ISO	Madcam1 (Mus musculus)	6480464	Itraconazole inhibits the reaction [TNF protein results in increased expression of MADCAM1 protein]	CTD	PMID:12388057
Madcam1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of MADCAM1 mRNA	CTD	PMID:24780913
Madcam1	Rat	alpha-amanitin	affects expression	ISO	Madcam1 (Mus musculus)	6480464	Alpha-Amanitin affects the expression of MADCAM1 mRNA	CTD	PMID:38531469
Madcam1	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of MADCAM1 mRNA	CTD	PMID:16483693
Madcam1	Rat	amphotericin B	increases expression	ISO	MADCAM1 (Homo sapiens)	6480464	Amphotericin B analog results in increased expression of MADCAM1 mRNA	CTD	PMID:28534445
Madcam1	Rat	benzo[a]pyrene	affects methylation	ISO	MADCAM1 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of MADCAM1 promoter	CTD	PMID:27901495
Madcam1	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of MADCAM1 mRNA	CTD	PMID:25181051
Madcam1	Rat	butanal	decreases expression	ISO	MADCAM1 (Homo sapiens)	6480464	butyraldehyde results in decreased expression of MADCAM1 mRNA	CTD	PMID:26079696
Madcam1	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of MADCAM1 mRNA	CTD	PMID:26577399
Madcam1	Rat	curcumin	multiple interactions	ISO	Madcam1 (Mus musculus)	6480464	Curcumin inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of MADCAM1 mRNA]	CTD	PMID:18200517
Madcam1	Rat	cyclosporin A	increases expression	ISO	Madcam1 (Mus musculus)	6480464	Cyclosporine results in increased expression of MADCAM1 mRNA and Cyclosporine results in increased expression of MADCAM1 protein	CTD	PMID:21292993
Madcam1	Rat	cyclosporin A	decreases methylation	ISO	MADCAM1 (Homo sapiens)	6480464	Cyclosporine results in decreased methylation of MADCAM1 promoter	CTD	PMID:27989131
Madcam1	Rat	DDE	decreases expression	ISO	MADCAM1 (Homo sapiens)	6480464	Dichlorodiphenyl Dichloroethylene results in decreased expression of MADCAM1 mRNA	CTD	PMID:38568856
Madcam1	Rat	dexamethasone	multiple interactions	ISO	Madcam1 (Mus musculus)	6480464	Dexamethasone inhibits the reaction [TNF protein results in increased expression of MADCAM1 mRNA] and Dexamethasone inhibits the reaction [TNF protein results in increased expression of MADCAM1 protein]	CTD	PMID:11472325
Madcam1	Rat	dibenziodolium	multiple interactions	ISO	Madcam1 (Mus musculus)	6480464	diphenyleneiodonium inhibits the reaction [TNF protein results in increased expression of MADCAM1 protein]	CTD	PMID:12388057
Madcam1	Rat	diethylstilbestrol	increases expression	EXP		6480464	Diethylstilbestrol results in increased expression of MADCAM1 mRNA	CTD	PMID:36653537
Madcam1	Rat	dorsomorphin	multiple interactions	ISO	MADCAM1 (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] affects the expression of MADCAM1 mRNA	CTD	PMID:27188386
Madcam1	Rat	entinostat	multiple interactions	ISO	MADCAM1 (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] affects the expression of MADCAM1 mRNA	CTD	PMID:27188386
Madcam1	Rat	entinostat	increases expression	ISO	MADCAM1 (Homo sapiens)	6480464	entinostat results in increased expression of MADCAM1 mRNA	CTD	PMID:26272509
Madcam1	Rat	folic acid	multiple interactions	ISO	Madcam1 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of MADCAM1 mRNA	CTD	PMID:22206623
Madcam1	Rat	itraconazole	multiple interactions	ISO	Madcam1 (Mus musculus)	6480464	Itraconazole inhibits the reaction [TNF protein results in increased expression of MADCAM1 protein]	CTD	PMID:12388057
Madcam1	Rat	ketoconazole	multiple interactions	ISO	Madcam1 (Mus musculus)	6480464	Ketoconazole inhibits the reaction [TNF protein results in increased expression of MADCAM1 protein]	CTD	PMID:12388057
Madcam1	Rat	manganese(II) chloride	increases expression	EXP		6480464	manganese chloride results in increased expression of MADCAM1 mRNA	CTD	PMID:28801915
Madcam1	Rat	N-acetyl-L-cysteine	multiple interactions	ISO	Madcam1 (Mus musculus)	6480464	Acetylcysteine inhibits the reaction [TNF protein results in increased expression of MADCAM1 protein]	CTD	PMID:12388057
Madcam1	Rat	N-methyl-N-nitrosourea	increases expression	ISO	Madcam1 (Mus musculus)	6480464	Methylnitrosourea results in increased expression of MADCAM1 mRNA	CTD	PMID:15240709
Madcam1	Rat	paracetamol	decreases expression	ISO	Madcam1 (Mus musculus)	6480464	Acetaminophen results in decreased expression of MADCAM1 mRNA	CTD	PMID:17585979
Madcam1	Rat	paracetamol	increases expression	ISO	MADCAM1 (Homo sapiens)	6480464	Acetaminophen results in increased expression of MADCAM1 mRNA	CTD	PMID:29067470
Madcam1	Rat	paracetamol	affects expression	ISO	Madcam1 (Mus musculus)	6480464	Acetaminophen affects the expression of MADCAM1 mRNA	CTD	PMID:17562736
Madcam1	Rat	pentanal	decreases expression	ISO	MADCAM1 (Homo sapiens)	6480464	pentanal results in decreased expression of MADCAM1 mRNA	CTD	PMID:26079696
Madcam1	Rat	pyrrolidine dithiocarbamate	multiple interactions	ISO	Madcam1 (Mus musculus)	6480464	pyrrolidine dithiocarbamic acid inhibits the reaction [TNF protein results in increased expression of MADCAM1 protein]	CTD	PMID:12388057
Madcam1	Rat	resveratrol	multiple interactions	ISO	MADCAM1 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of MADCAM1 mRNA	CTD	PMID:23557933
Madcam1	Rat	SB 431542	multiple interactions	ISO	MADCAM1 (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] affects the expression of MADCAM1 mRNA	CTD	PMID:27188386
Madcam1	Rat	silicon dioxide	decreases expression	ISO	MADCAM1 (Homo sapiens)	6480464	Silicon Dioxide analog results in decreased expression of MADCAM1 mRNA	CTD	PMID:25895662
Madcam1	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of MADCAM1 mRNA	CTD	PMID:33387578
Madcam1	Rat	triphenyl phosphate	affects expression	ISO	MADCAM1 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of MADCAM1 mRNA	CTD	PMID:37042841
Madcam1	Rat	triptonide	increases expression	ISO	Madcam1 (Mus musculus)	6480464	triptonide results in increased expression of MADCAM1 mRNA	CTD	PMID:33045310
Madcam1	Rat	troleandomycin	multiple interactions	ISO	Madcam1 (Mus musculus)	6480464	Troleandomycin inhibits the reaction [TNF protein results in increased expression of MADCAM1 protein]	CTD	PMID:12388057
Madcam1	Rat	valproic acid	increases methylation	ISO	MADCAM1 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of MADCAM1 gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Madcam1	Rat	cell adhesion		IDA		724402		RGD
Madcam1	Rat	cell adhesion	involved_in	IEA	InterPro:IPR015169 and InterPro:IPR037413	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Madcam1	Rat	cell adhesion	involved_in	IEA	UniProtKB-KW:KW-0130	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Madcam1	Rat	cell-cell adhesion	involved_in	IEA	InterPro:IPR003987	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Madcam1	Rat	cell-matrix adhesion	involved_in	ISO	MADCAM1 (Homo sapiens)	1624291	PMID:18308860	RGD	PMID:18308860
Madcam1	Rat	cell-matrix adhesion	involved_in	IEA	GO:0098640	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Madcam1	Rat	heterotypic cell-cell adhesion	involved_in	ISO	MADCAM1 (Homo sapiens)	1624291	PMID:18308860	RGD	PMID:18308860
Madcam1	Rat	heterotypic cell-cell adhesion	involved_in	IBA	PANTHER:PTN001799186 and UniProtKB:Q13477	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Madcam1	Rat	integrin-mediated signaling pathway	involved_in	IEA	InterPro:IPR037413	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Madcam1	Rat	integrin-mediated signaling pathway	involved_in	IBA	PANTHER:PTN001799186 and UniProtKB:Q13477	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Madcam1	Rat	integrin-mediated signaling pathway	involved_in	ISO	MADCAM1 (Homo sapiens)	1624291	PMID:23986478	RGD	PMID:23986478
Madcam1	Rat	keratinocyte differentiation	acts_upstream_of_or_within	ISO	Madcam1 (Mus musculus)	1624291	PMID:12230506	RGD	PMID:12230506
Madcam1	Rat	leukocyte migration	acts_upstream_of_or_within	ISO	Madcam1 (Mus musculus)	1624291	PMID:15484189	RGD	PMID:15484189
Madcam1	Rat	leukocyte tethering or rolling	involved_in	ISO	MADCAM1 (Homo sapiens)	1624291	PMID:18308860	RGD	PMID:18308860
Madcam1	Rat	leukocyte tethering or rolling	involved_in	IBA	PANTHER:PTN001799186 and UniProtKB:Q13477	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Madcam1	Rat	positive regulation of leukocyte migration		IMP		2311549		RGD
Madcam1	Rat	positive regulation of leukocyte migration	involved_in	IBA	PANTHER:PTN001799186 and Madcam1 (Rattus norvegicus)	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Madcam1	Rat	positive regulation of lymphocyte migration	involved_in	IEA	InterPro:IPR037413	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Madcam1	Rat	receptor clustering	involved_in	ISO	MADCAM1 (Homo sapiens)	1624291	PMID:23986478	RGD	PMID:23986478

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Madcam1	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Madcam1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Madcam1	Rat	membrane	located_in	IEA	InterPro:IPR003987 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Madcam1	Rat	plasma membrane	located_in	IEA	GO:0043113	1600115	GO_REF:0000108	GOC	GO_REF:0000108

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Madcam1	Rat	integrin binding involved in cell-matrix adhesion	enables	IEA	InterPro:IPR037413	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Madcam1	Rat	integrin binding involved in cell-matrix adhesion	enables	IBA	PANTHER:PTN001799186 and UniProtKB:Q13477	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Madcam1	Rat	integrin binding involved in cell-matrix adhesion	enables	ISO	MADCAM1 (Homo sapiens)	1624291	PMID:23986478	RGD	PMID:23986478

#	Reference Title	Reference Citation
1.	Aberrant endometrial features of pregnancy in diabetic NOD mice.	Burke SD, etal., Diabetes. 2007 Dec;56(12):2919-26. Epub 2007 Sep 7.
2.	Treatment with an antibody to VLA-1 integrin reduces glomerular and tubulointerstitial scarring in a rat model of crescentic glomerulonephritis.	Cook HT, etal., Am J Pathol 2002 Oct;161(4):1265-72.
3.	Immunohistochemical analysis of MAdCAM-1 expression during acute rejection on small bowel grafts in rats.	Fujisaki S, etal., Transplant Proc 2002 May;34(3):1045-6.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Involvement of mucosal addressin cell adhesion molecule-1 (MAdCAM-1) in the pathogenesis of granulomatous colitis in rats.	Hokari R, etal., Clin Exp Immunol. 2001 Nov;126(2):259-65.
6.	Expression of adhesion molecules in the rectum-associated lymph nodules of pre- and postnatal specific pathogen-free rats.	Ichikawa S and Yamashita A, J Gastroenterol Hepatol 2003 Aug;18(8):970-979.
7.	Cloning and characterization of the rat MAdCAM-1 cDNA and gene.	Iizuka T, etal., Biochim Biophys Acta 1998 Feb 11;1395(3):266-70.
8.	Stage-specific expression of mucosal addressin cell adhesion molecule-1 during embryogenesis in rats.	Iizuka T, etal., J Immunol. 2000 Mar 1;164(5):2463-71.
9.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
10.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.	Chronic allergy to dietary ovalbumin induces lymphocyte migration to rat small intestinal mucosa that is inhibited by MAdCAM-1.	Ogawa T, etal., Am J Physiol Gastrointest Liver Physiol. 2004 May;286(5):G702-10. Epub 2003 Dec 11.
12.	GOA pipeline	RGD automated data pipeline
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Comprehensive gene review and curation	RGD comprehensive gene curation
15.	Basis for the age-related decline in intestinal mucosal immunity.	Schmucker DL, etal., Clin Dev Immunol. 2003 Jun-Dec;10(2-4):167-72.
16.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
17.	Involvement of beta 7 integrin and mucosal addressin cell adhesion molecule-1 (MAdCAM-1) in the development of diabetes in obese diabetic mice.	Yang XD, etal., Diabetes. 1997 Oct;46(10):1542-7.

PMID:12230506	PMID:15484189	PMID:16387148	PMID:18308860	PMID:23986478

Madcam1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	10,686,920 - 10,690,322 (-)	NCBI		GRCr8
mRatBN7.2	7	10,036,301 - 10,039,703 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	10,036,301 - 10,039,703 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	12,917,270 - 12,920,672 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	14,795,349 - 14,798,751 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	12,654,653 - 12,658,055 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	12,918,352 - 12,922,509 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	12,918,710 - 12,922,112 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	13,087,337 - 13,092,220 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	11,553,219 - 11,556,621 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	11,553,218 - 11,556,621 (-)	NCBI
Celera	7	8,209,542 - 8,212,944 (-)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

MADCAM1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	496,486 - 505,343 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	489,176 - 505,343 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	496,486 - 505,343 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	447,490 - 456,343 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	447,489 - 456,342	NCBI
Celera	19	312,275 - 321,128 (-)	NCBI		Celera
Cytogenetic Map	19	p13.3	NCBI
HuRef	19	266,619 - 275,499 (+)	NCBI		HuRef
CHM1_1	19	496,085 - 504,846 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	448,988 - 457,915 (+)	NCBI		T2T-CHM13v2.0

Madcam1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	79,500,393 - 79,504,376 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	79,500,393 - 79,504,371 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	79,664,559 - 79,668,542 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	79,664,559 - 79,668,537 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	79,127,319 - 79,131,281 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	79,067,712 - 79,071,665 (+)	NCBI		MGSCv36	mm8
Celera	10	80,678,309 - 80,682,271 (+)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	39.72	NCBI

Madcam1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955495	7,190,009 - 7,194,966 (-)	NCBI	ChiLan1.0	ChiLan1.0

MADCAM1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	4,824,294 - 4,834,516 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	4,063,146 - 4,074,931 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	627,526 - 636,684 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	467,651 - 478,208 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	468,026 - 477,830 (+)	Ensembl	panpan1.1		panPan2

MADCAM1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	57,978,189 - 57,981,966 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	57,978,185 - 57,981,966 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	57,780,967 - 57,784,744 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	58,721,763 - 58,725,542 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	58,721,759 - 58,725,542 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	57,775,339 - 57,779,116 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	58,255,185 - 58,258,962 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	58,458,457 - 58,462,234 (-)	NCBI		UU_Cfam_GSD_1.0

Madcam1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	217,685,617 - 217,689,136 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936588	145,696 - 149,158 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MADCAM1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	77,784,612 - 77,789,067 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	77,784,610 - 77,789,036 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

LOC103233562
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	222,795 - 235,198 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666081	8,890,323 - 8,901,527 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Madcam1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624828	7,954,745 - 7,958,398 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624828	7,953,693 - 7,959,518 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Madcam1
5 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	67
Count of miRNA genes:	56
Interacting mature miRNAs:	62
Transcripts:	ENSRNOT00000010938
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	44782185	Rat
1300176	Hrtrt10	Heart rate QTL 10	3.19		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	664270	26029351	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	5329019	50329019	Rat
1578652	Bmd15	Bone mineral density QTL 15	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	7	9866467	60460686	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1	44822433	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
10755438	Coatc9	Coat color QTL 9		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	3529280	48529280	Rat
9590142	Scort5	Serum corticosterone level QTL 5	24.4	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	1	31962314	Rat
2298547	Neuinf5	Neuroinflammation QTL 5	3.7		nervous system integrity trait (VT:0010566)	spinal cord Cd74 protein level (CMO:0002131)	7	9462246	58265113	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	7573985	52573985	Rat
2317047	Wbc4	White blood cell count QTL 4		0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	7	1	35342956	Rat
10755440	Coatc10	Coat color QTL 10		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	7496499	52496499	Rat
2298550	Neuinf6	Neuroinflammation QTL 6	3.3		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	7	1	27829089	Rat
724560	Plsm3	Polydactyly-luxate syndrome (PLS) morphotypes QTL 3		0.0003	tibia length (VT:0004357)	tibia length (CMO:0000450)	7	1	34000259	Rat
7411566	Bw136	Body weight QTL 136	10.4	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	1	31962314	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	8	43	104	48	46	18	24	18	5	156	89	86	35	60	28


RefSeq Transcripts	NM_019317	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008765179	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC097878	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D87840	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010938 ⟹ ENSRNOP00000010939

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	10,036,301 - 10,039,703 (-)	Ensembl
Rnor_6.0 Ensembl	7	12,918,710 - 12,922,112 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096335 ⟹ ENSRNOP00000089873

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	10,036,382 - 10,039,703 (-)	Ensembl

RefSeq Acc Id:

NM_019317 ⟹ NP_062190

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	10,686,920 - 10,690,322 (-)	NCBI
mRatBN7.2	7	10,036,301 - 10,039,703 (-)	NCBI
Rnor_6.0	7	12,918,710 - 12,922,112 (-)	NCBI
Rnor_5.0	7	13,087,337 - 13,092,220 (-)	NCBI
RGSC_v3.4	7	11,553,219 - 11,556,621 (-)	RGD
Celera	7	8,209,542 - 8,212,944 (-)	RGD

Sequence:

show sequence

GACAGAGAAAGGCATGGAGCCCATCCTGGCCCTCCTGCTGGCCCTGGGACCCTTCCAGCTCAGCAGAGGCCAGTCCTTCCAGGTGAATCCTCCTGAGCCTGAGGTAGCTGTAGCCATGGGCACATCCC
TCCAGATCAACTGCAGCATGTCCTGTGACAAGGATATAGCCCGGGTGCACTGGCATGGCCTGGACACCAACCTGGGCAATGTGCAGACCCTCCCAGGCAGCAGGGTCCTCTCCGTACGAGGCATGCTG
TCAGACACGGGCACTCGTGTATGCGTGGGTTCCTGTGGGAGTCGAAGCTTTCAGCACTCTGTGAAGATCCTTGTGTATGCCTTTCCAGACCAGCTGGAGGTAACCCCGGAGTTCCTTGTACCTGGACG
GGACCAGGTAGTGTCCTGCACAGCCCACAACATCTGGCCTGCAGGCCCGGACAGTCTTTCCTTTGCCTTGCTCCGAGGAGAGCAGAGCCTGGAGGGTGCTCAGGCCCTGGAAACAGAGCAAGAGGAGG
AGATGCAAGAGACTGAGGGCACTCCACTCTTCCAAGTGACACAACGCTGGTTGCTGCCCTCCCTGGGGACCCCCGCCCTTCCCGCCCTTTATTGCCAGGTCACCATGCAGCTGCCCAAACTGGTGCTG
ACACATAGAAGGAAGATTCCAGTCCTACAGAGCCAGACCTCACCAGAGCCCCCCAGCACCACCTCTGCTAAGCCATACATCCTGACCTCATCACATACTACTAAGGCAGTCTCCACTGGGCTCAGCAG
TGTAGCCCTGCCTTCTACGCCTCTGAGCTCCGAGGGGCCCTGCTACCCCGAAATCCACCAGAACCCAGAGGCAGACTGGGAACTTCTCTGCGAAGCCTCCTGTGGGTCTGGAGTGACGGTGCATTGGA
CCCTGGCTCCTGGTGACCTGGCAGCCTACCACAAGAGAGAAGCTGGGGCCCAGGCATGGCTAAGCGTGCTGCCCCTGGGCCCCATTCCTGAGGGCTGGTTCCAGTGTCGCATGGACCCTGGCGGGCAG
GTGACCAGTCTGTATGTTACTGGCCAGGTGATCCCAAACCCCTCCTCCATGGTCGCCCTGTGGATTGGCAGCTTGGTGCTGGGGCTGCTTGCACTCGCCTTCCTTGCCTACTGCCTGTGGAAACGCTA
CCGGCCGGGTCCTCTCCCAGACTCCAGCTCGTGTACGCTCCTATGAAGTTCCATTATGCCAGACTAAGGGAGGCAAAGGATTACCAGATGTAGGTTTGGGGCATCAAGATGATAGTGTGGCCCCTTT

hide sequence


Protein RefSeqs	NP_062190	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA25260	(Get FASTA)	NCBI Sequence Viewer
	EDL89413	(Get FASTA)	NCBI Sequence Viewer
	EDL89414	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010939.1
GenBank Protein	O70540	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_062190 ⟸ NM_019317
- Peptide Label:	precursor
- UniProtKB:	O70540 (UniProtKB/Swiss-Prot), A6K8Z4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEPILALLLALGPFQLSRGQSFQVNPPEPEVAVAMGTSLQINCSMSCDKDIARVHWHGLDTNLGNVQTLPGSRVLSVRGMLSDTGTRVCVGSCGSRSFQHSVKILVYAFPDQLEVTPEFLVPGRDQVV SCTAHNIWPAGPDSLSFALLRGEQSLEGAQALETEQEEEMQETEGTPLFQVTQRWLLPSLGTPALPALYCQVTMQLPKLVLTHRRKIPVLQSQTSPEPPSTTSAKPYILTSSHTTKAVSTGLSSVALP STPLSSEGPCYPEIHQNPEADWELLCEASCGSGVTVHWTLAPGDLAAYHKREAGAQAWLSVLPLGPIPEGWFQCRMDPGGQVTSLYVTGQVIPNPSSMVALWIGSLVLGLLALAFLAYCLWKRYRPGP LPDSSSCTLL hide sequence

Ensembl Acc Id:

ENSRNOP00000010939 ⟸ ENSRNOT00000010938

Ensembl Acc Id:

ENSRNOP00000089873 ⟸ ENSRNOT00000096335

Protein Domains

Adhesion molecule immunoglobulin-like Ig-like

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O70540-F1-model_v2	AlphaFold	O70540	1-394	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-34879	BioCyc
Ensembl Genes	ENSRNOG00000008217	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000010938.3	UniProtKB/Swiss-Prot
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot
InterPro	Adhes-Ig-like	UniProtKB/Swiss-Prot
	ICAM_VCAM_N	UniProtKB/Swiss-Prot
	Ig-like_dom_sf	UniProtKB/Swiss-Prot
	Ig-like_fold	UniProtKB/Swiss-Prot
	MADCAM1	UniProtKB/Swiss-Prot
KEGG Report	rno:54266	UniProtKB/Swiss-Prot
NCBI Gene	54266	ENTREZGENE
PANTHER	MUCOSAL ADDRESSIN CELL ADHESION MOLECULE 1	UniProtKB/Swiss-Prot
	PTHR14162	UniProtKB/Swiss-Prot
Pfam	Adhes-Ig_like	UniProtKB/Swiss-Prot
PhenoGen	Madcam1	PhenoGen
PRINTS	ICAMVCAM1	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000008217	RatGTEx
Superfamily-SCOP	SSF48726	UniProtKB/Swiss-Prot
TIGR	TC211744
UniProt	A0A8I6AAQ2_RAT	UniProtKB/TrEMBL
	A6K8Z3_RAT	UniProtKB/TrEMBL
	A6K8Z4	ENTREZGENE, UniProtKB/TrEMBL
	MADCA_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Madcam1	Mucosal vascular addressin cell adhesion molecule 1			Symbol and Name status set to approved	70586	APPROVED

Note Type	Note	Reference
gene_expression	expressed in endothelial cells of blood vessels in the entire colonic mucosa until day 7 after birth	724402

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - CTD