Symbol:
Glyctk
Name:
glycerate kinase
RGD ID:
1591498
Description:
Enables glycerate kinase activity. Predicted to be involved in fructose catabolic process and protein phosphorylation. Is active in cytosol. Human ortholog(s) of this gene implicated in D-glyceric aciduria. Orthologous to human GLYCTK (glycerate kinase); PARTICIPATES IN D-glycericacidemia pathway; dihydropyrimidine dehydrogenase deficiency pathway; dimethylglycine dehydrogenase deficiency pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-diaminodiphenylmethane.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC684314; similar to CG9886-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GLYCTK (glycerate kinase) RGD
RGD
Mus musculus (house mouse):
Glyctk (glycerate kinase) RGD
RGD
Chinchilla lanigera (long-tailed chinchilla):
Glyctk (glycerate kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GLYCTK (glycerate kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GLYCTK (glycerate kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Glyctk (glycerate kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GLYCTK (glycerate kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GLYCTK (glycerate kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Glyctk (glycerate kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
GLYCTK (glycerate kinase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Glyctk (glycerate kinase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
glyctk (glycerate kinase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
C13B9.2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG9886
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
glyctk
Alliance
DIOPT (OMA|OrthoFinder)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 115,676,071 - 115,681,403 (-) NCBI GRCr8 mRatBN7.2 8 106,795,461 - 106,802,675 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 106,797,343 - 106,802,397 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 112,421,933 - 112,426,948 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 110,621,106 - 110,626,120 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 108,463,912 - 108,468,926 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 114,846,210 - 114,853,374 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 114,848,084 - 114,853,103 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 114,211,573 - 114,218,732 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 8 106,120,103 - 106,125,121 (-) NCBI Celera Cytogenetic Map 8 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Glyctk Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of GLYCTK mRNA] CTD PMID:31150632 Glyctk Rat (1->4)-beta-D-glucan multiple interactions ISO Glyctk (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of GLYCTK mRNA CTD PMID:36331819 Glyctk Rat 1,1-dichloroethene decreases expression ISO Glyctk (Mus musculus) 6480464 vinylidene chloride results in decreased expression of GLYCTK mRNA CTD PMID:26682919 Glyctk Rat 1,2-dimethylhydrazine decreases expression ISO Glyctk (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of GLYCTK mRNA CTD PMID:22206623 Glyctk Rat 17beta-estradiol decreases expression ISO Glyctk (Mus musculus) 6480464 Estradiol results in decreased expression of GLYCTK mRNA CTD PMID:39298647 Glyctk Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO GLYCTK (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of GLYCTK mRNA CTD PMID:20106945 and PMID:21632981 Glyctk Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of GLYCTK mRNA CTD PMID:33387578 Glyctk Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Glyctk (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of GLYCTK mRNA CTD PMID:21570461 and PMID:26377647 Glyctk Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of GLYCTK mRNA CTD PMID:30723492 Glyctk Rat 4,4'-sulfonyldiphenol decreases expression ISO Glyctk (Mus musculus) 6480464 bisphenol S results in decreased expression of GLYCTK mRNA CTD PMID:30951980 Glyctk Rat 4,4'-sulfonyldiphenol affects methylation ISO Glyctk (Mus musculus) 6480464 bisphenol S affects the methylation of GLYCTK gene CTD PMID:31683443 Glyctk Rat 4,4'-sulfonyldiphenol affects expression ISO Glyctk (Mus musculus) 6480464 bisphenol S affects the expression of GLYCTK mRNA CTD PMID:39298647 Glyctk Rat 4-hydroxyphenyl retinamide increases expression ISO Glyctk (Mus musculus) 6480464 Fenretinide results in increased expression of GLYCTK mRNA CTD PMID:28973697 Glyctk Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of GLYCTK mRNA CTD PMID:31881176 Glyctk Rat aflatoxin B1 affects expression ISO GLYCTK (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of GLYCTK protein CTD PMID:20106945 Glyctk Rat aflatoxin B1 decreases methylation ISO GLYCTK (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of GLYCTK intron CTD PMID:30157460 Glyctk Rat aflatoxin B1 decreases expression ISO GLYCTK (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of GLYCTK mRNA CTD PMID:22100608 and PMID:27153756 Glyctk Rat benzo[a]pyrene affects methylation ISO GLYCTK (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GLYCTK intron CTD PMID:30157460 Glyctk Rat benzo[a]pyrene decreases expression ISO GLYCTK (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of GLYCTK mRNA CTD PMID:32234424 Glyctk Rat beta-lapachone decreases expression ISO GLYCTK (Homo sapiens) 6480464 beta-lapachone results in decreased expression of GLYCTK mRNA CTD PMID:38218311 Glyctk Rat bis(2-ethylhexyl) phthalate increases expression ISO Glyctk (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of GLYCTK mRNA CTD PMID:34319233 Glyctk Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GLYCTK mRNA CTD PMID:25181051 more ... Glyctk Rat bisphenol A increases expression ISO Glyctk (Mus musculus) 6480464 bisphenol A results in increased expression of GLYCTK mRNA CTD PMID:33221593 Glyctk Rat bisphenol A affects expression ISO GLYCTK (Homo sapiens) 6480464 bisphenol A affects the expression of GLYCTK mRNA CTD PMID:30903817 Glyctk Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of GLYCTK mRNA CTD PMID:30903817 Glyctk Rat bisphenol A decreases expression ISO Glyctk (Mus musculus) 6480464 bisphenol A results in decreased expression of GLYCTK mRNA CTD PMID:30951980 Glyctk Rat bisphenol A increases expression ISO GLYCTK (Homo sapiens) 6480464 bisphenol A results in increased expression of GLYCTK mRNA CTD PMID:27685785 Glyctk Rat bisphenol F decreases expression ISO Glyctk (Mus musculus) 6480464 bisphenol F results in decreased expression of GLYCTK mRNA CTD PMID:30951980 Glyctk Rat buta-1,3-diene decreases expression ISO Glyctk (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of GLYCTK mRNA CTD PMID:29038090 Glyctk Rat butanal decreases expression ISO GLYCTK (Homo sapiens) 6480464 butyraldehyde results in decreased expression of GLYCTK mRNA CTD PMID:26079696 Glyctk Rat cadmium dichloride increases expression ISO GLYCTK (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of GLYCTK mRNA CTD PMID:38382870 Glyctk Rat carbamazepine affects expression ISO GLYCTK (Homo sapiens) 6480464 Carbamazepine affects the expression of GLYCTK mRNA CTD PMID:24752500 Glyctk Rat carbon nanotube increases expression ISO Glyctk (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Glyctk Rat CGP 52608 multiple interactions ISO GLYCTK (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to GLYCTK gene] CTD PMID:28238834 Glyctk Rat cisplatin multiple interactions ISO GLYCTK (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of GLYCTK mRNA CTD PMID:27392435 Glyctk Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of GLYCTK mRNA CTD PMID:24386269 Glyctk Rat copper(II) sulfate decreases expression ISO GLYCTK (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of GLYCTK mRNA CTD PMID:19549813 Glyctk Rat cyclosporin A decreases expression ISO GLYCTK (Homo sapiens) 6480464 Cyclosporine results in decreased expression of GLYCTK mRNA CTD PMID:20106945 and PMID:25562108 Glyctk Rat diclofenac affects expression ISO GLYCTK (Homo sapiens) 6480464 Diclofenac affects the expression of GLYCTK mRNA CTD PMID:24752500 Glyctk Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of GLYCTK mRNA CTD PMID:29391264 Glyctk Rat epoxiconazole decreases expression ISO Glyctk (Mus musculus) 6480464 epoxiconazole results in decreased expression of GLYCTK mRNA CTD PMID:35436446 Glyctk Rat fulvestrant increases methylation ISO GLYCTK (Homo sapiens) 6480464 Fulvestrant results in increased methylation of GLYCTK gene CTD PMID:31601247 Glyctk Rat GW 4064 increases expression ISO Glyctk (Mus musculus) 6480464 GW 4064 results in increased expression of GLYCTK mRNA CTD PMID:26655953 Glyctk Rat hydrogen peroxide affects expression ISO GLYCTK (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of GLYCTK mRNA CTD PMID:20044591 Glyctk Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of GLYCTK mRNA CTD PMID:36868495 Glyctk Rat inulin multiple interactions ISO Glyctk (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of GLYCTK mRNA CTD PMID:36331819 Glyctk Rat lead(0) increases expression ISO GLYCTK (Homo sapiens) 6480464 Lead results in increased expression of GLYCTK mRNA CTD PMID:19921347 Glyctk Rat menadione affects expression ISO GLYCTK (Homo sapiens) 6480464 Vitamin K 3 affects the expression of GLYCTK mRNA CTD PMID:20044591 Glyctk Rat methamphetamine increases methylation ISO Glyctk (Mus musculus) 6480464 Methamphetamine results in increased methylation of GLYCTK promoter CTD PMID:26307267 Glyctk Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of GLYCTK mRNA CTD PMID:30467583 Glyctk Rat N-Nitrosopyrrolidine decreases expression ISO GLYCTK (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of GLYCTK mRNA CTD PMID:32234424 Glyctk Rat O-methyleugenol decreases expression ISO GLYCTK (Homo sapiens) 6480464 methyleugenol results in decreased expression of GLYCTK mRNA CTD PMID:32234424 Glyctk Rat paracetamol affects expression ISO Glyctk (Mus musculus) 6480464 Acetaminophen affects the expression of GLYCTK mRNA CTD PMID:17562736 Glyctk Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of GLYCTK mRNA CTD PMID:33387578 Glyctk Rat paracetamol decreases expression ISO GLYCTK (Homo sapiens) 6480464 Acetaminophen results in decreased expression of GLYCTK mRNA CTD PMID:25704631 Glyctk Rat pentanal decreases expression ISO GLYCTK (Homo sapiens) 6480464 pentanal results in decreased expression of GLYCTK mRNA CTD PMID:26079696 Glyctk Rat perfluorononanoic acid decreases expression ISO GLYCTK (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of GLYCTK mRNA CTD PMID:32588087 Glyctk Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Glyctk (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of GLYCTK mRNA more ... CTD PMID:36331819 Glyctk Rat pirinixic acid multiple interactions ISO GLYCTK (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of GLYCTK mRNA CTD PMID:19710929 Glyctk Rat propanal decreases expression ISO GLYCTK (Homo sapiens) 6480464 propionaldehyde results in decreased expression of GLYCTK mRNA CTD PMID:26079696 Glyctk Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of GLYCTK protein CTD PMID:29459688 Glyctk Rat sodium arsenite decreases expression ISO GLYCTK (Homo sapiens) 6480464 sodium arsenite results in decreased expression of GLYCTK mRNA CTD PMID:29301061 Glyctk Rat sodium dichromate affects expression EXP 6480464 sodium bichromate affects the expression of GLYCTK mRNA CTD PMID:22110744 Glyctk Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of GLYCTK mRNA CTD PMID:19281266 Glyctk Rat tetrachloromethane multiple interactions EXP 6480464 [Olive Oil analog co-treated with Carbon Tetrachloride] affects the expression of GLYCTK protein and schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of GLYCTK mRNA] CTD PMID:25303780 and PMID:31150632 Glyctk Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of GLYCTK mRNA CTD PMID:31150632 Glyctk Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of GLYCTK mRNA CTD PMID:34492290 Glyctk Rat titanium dioxide increases expression ISO Glyctk (Mus musculus) 6480464 titanium dioxide results in increased expression of GLYCTK mRNA CTD PMID:35295148 Glyctk Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of GLYCTK mRNA CTD PMID:33387578 Glyctk Rat valproic acid affects expression ISO Glyctk (Mus musculus) 6480464 Valproic Acid affects the expression of GLYCTK mRNA CTD PMID:17963808 Glyctk Rat valproic acid decreases expression ISO GLYCTK (Homo sapiens) 6480464 Valproic Acid results in decreased expression of GLYCTK mRNA CTD PMID:29154799
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) acetamide (EXP) aflatoxin B1 (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buta-1,3-diene (ISO) butanal (ISO) cadmium dichloride (ISO) carbamazepine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) cisplatin (ISO) cobalt dichloride (EXP) copper(II) sulfate (ISO) cyclosporin A (ISO) diclofenac (ISO) endosulfan (EXP) epoxiconazole (ISO) fulvestrant (ISO) GW 4064 (ISO) hydrogen peroxide (ISO) indometacin (EXP) inulin (ISO) lead(0) (ISO) menadione (ISO) methamphetamine (ISO) methapyrilene (EXP) N-Nitrosopyrrolidine (ISO) O-methyleugenol (ISO) paracetamol (EXP,ISO) pentanal (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) propanal (ISO) sodium arsenite (EXP,ISO) sodium dichromate (EXP) Soman (EXP) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) valproic acid (ISO)
Glyctk Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 115,676,071 - 115,681,403 (-) NCBI GRCr8 mRatBN7.2 8 106,795,461 - 106,802,675 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 106,797,343 - 106,802,397 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 112,421,933 - 112,426,948 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 110,621,106 - 110,626,120 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 108,463,912 - 108,468,926 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 114,846,210 - 114,853,374 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 114,848,084 - 114,853,103 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 114,211,573 - 114,218,732 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 8 106,120,103 - 106,125,121 (-) NCBI Celera Cytogenetic Map 8 q32 NCBI
GLYCTK Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 52,287,828 - 52,295,257 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 52,287,089 - 52,295,257 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 52,321,844 - 52,329,273 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 52,296,912 - 52,302,532 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 3 52,301,159 - 52,308,595 (+) NCBI Celera Cytogenetic Map 3 p21.2 NCBI HuRef 3 52,384,478 - 52,391,914 (+) NCBI HuRef CHM1_1 3 52,274,371 - 52,281,807 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 52,320,727 - 52,349,445 (+) NCBI T2T-CHM13v2.0
Glyctk Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 106,030,058 - 106,037,353 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 106,030,056 - 106,035,337 (-) Ensembl GRCm39 Ensembl GRCm38 9 106,152,859 - 106,160,158 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 106,152,857 - 106,158,138 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 106,055,191 - 106,060,469 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 106,010,961 - 106,016,239 (-) NCBI MGSCv36 mm8 Celera 9 105,776,846 - 105,782,154 (-) NCBI Celera Cytogenetic Map 9 F1 NCBI cM Map 9 57.46 NCBI
Glyctk Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955532 3,936,160 - 3,942,868 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955532 3,933,964 - 3,939,858 (+) NCBI ChiLan1.0 ChiLan1.0
GLYCTK Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 52,282,866 - 52,290,724 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 52,287,680 - 52,295,495 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 52,230,128 - 52,237,561 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 53,459,271 - 53,466,702 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 53,458,563 - 53,466,702 (+) Ensembl panpan1.1 panPan2
GLYCTK Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 37,462,651 - 37,495,581 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 37,462,659 - 37,465,807 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 37,442,602 - 37,477,128 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 37,811,192 - 37,845,947 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 37,788,578 - 37,845,938 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 37,175,116 - 37,209,637 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 37,583,786 - 37,618,386 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 37,868,469 - 37,902,996 (-) NCBI UU_Cfam_GSD_1.0
Glyctk Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 66,866,696 - 66,872,727 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936529 3,628,822 - 3,635,236 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936529 3,627,194 - 3,635,568 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GLYCTK Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 34,433,399 - 34,440,264 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 34,433,403 - 34,440,037 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 37,565,182 - 37,572,167 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GLYCTK Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 13,648,499 - 13,653,813 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 13,651,024 - 13,653,801 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 153,247,974 - 153,253,449 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Glyctk
.
Predicted Target Of
Count of predictions: 50 Count of miRNA genes: 44 Interacting mature miRNAs: 49 Transcripts: ENSRNOT00000074595 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 738011 Anxrr9 Anxiety related response QTL 9 6.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 8 93535351 123900184 Rat 8693654 Alc32 Alcohol consumption QTL 32 2 0.755 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 8 88612425 107550209 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 738014 Anxrr15 Anxiety related response QTL 15 3.6 0.005 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 95718998 123900184 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 2313400 Anxrr25 Anxiety related response QTL 25 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 8 89265192 114019816 Rat 2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358903 Bp252 Blood pressure QTL 252 7 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 724539 Cm19 Cardiac mass QTL 19 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 8 100149864 120994388 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2300182 Bmd56 Bone mineral density QTL 56 5.4 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 95718998 123900184 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 631217 Activ1 Activity QTL 1 15.9 voluntary movement trait (VT:0003491) number of photobeam interruptions in an experimental apparatus (CMO:0001517) 8 102370617 108923645 Rat 1358893 Bp263 Blood pressure QTL 263 5.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat 61437 Cia6 Collagen induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 82460758 122812818 Rat
BF397866
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 106,802,597 - 106,802,825 (+) MAPPER mRatBN7.2 Rnor_6.0 8 114,853,341 - 114,853,570 NCBI Rnor6.0 Rnor_5.0 8 114,218,704 - 114,218,933 UniSTS Rnor5.0 Celera 8 106,125,359 - 106,125,586 UniSTS RH 3.4 Map 8 1140.9 UniSTS
RH137469
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 106,799,416 - 106,799,599 (+) MAPPER mRatBN7.2 Rnor_6.0 8 114,850,162 - 114,850,344 NCBI Rnor6.0 Rnor_5.0 8 114,215,525 - 114,215,707 UniSTS Rnor5.0 Celera 8 106,122,182 - 106,122,364 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000074595 ⟹ ENSRNOP00000064339
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 106,797,343 - 106,802,397 (-) Ensembl Rnor_6.0 Ensembl 8 114,848,084 - 114,853,103 (-) Ensembl
RefSeq Acc Id:
NM_001109449 ⟹ NP_001102919
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 115,676,071 - 115,681,091 (-) NCBI mRatBN7.2 8 106,797,338 - 106,802,360 (-) NCBI Rnor_6.0 8 114,848,083 - 114,853,103 (-) NCBI Rnor_5.0 8 114,211,573 - 114,218,732 (-) NCBI Celera 8 106,120,103 - 106,125,121 (-) RGD
Sequence:
TCGGGGTTCCTCATTTAACAACCGGGGATGCACTGGAGCTGTGAAGGCAGCTATGGATGCAAGGCTGTGCTGAGAGAAGCGGGGCATGGCTGCAGCCCTACAGGTCTTGCCCTGTCTCCTCCGAGCCC
hide sequence
RefSeq Acc Id:
XM_006243856 ⟹ XP_006243918
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 115,676,071 - 115,679,488 (-) NCBI mRatBN7.2 8 106,795,461 - 106,800,731 (-) NCBI Rnor_6.0 8 114,846,210 - 114,851,521 (-) NCBI Rnor_5.0 8 114,211,573 - 114,218,732 (-) NCBI
Sequence:
TGGCAGTAAAAGTGGTAAAGCATAAATGTCAGAAAGGGGCACTGCCGTGTTGTAAGGGCTTTGAAAGTACAGGATGTGGAAAAGAATGGTACAGGAGCCCACTGGTAGGAATGGCTTCCTTCGTGAAT
hide sequence
RefSeq Acc Id:
XM_006243857 ⟹ XP_006243919
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 115,676,071 - 115,681,402 (-) NCBI mRatBN7.2 8 106,795,461 - 106,802,675 (-) NCBI Rnor_6.0 8 114,846,210 - 114,853,374 (-) NCBI Rnor_5.0 8 114,211,573 - 114,218,732 (-) NCBI
Sequence:
GAGTACTTCCGGTCTCCAACGCTAGAAGTTGCTGAAAGGAAAGGTTGCGTCTCAAGAACATAAA
hide sequence
RefSeq Acc Id:
XM_039082152 ⟹ XP_038938080
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 115,676,071 - 115,681,202 (-) NCBI mRatBN7.2 8 106,795,461 - 106,802,471 (-) NCBI
RefSeq Acc Id:
XM_039082155 ⟹ XP_038938083
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 115,676,071 - 115,678,992 (-) NCBI mRatBN7.2 8 106,795,461 - 106,800,259 (-) NCBI
RefSeq Acc Id:
XM_063266141 ⟹ XP_063122211
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 115,676,071 - 115,679,458 (-) NCBI
RefSeq Acc Id:
XM_063266142 ⟹ XP_063122212
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 115,676,071 - 115,681,403 (-) NCBI
RefSeq Acc Id:
XM_063266143 ⟹ XP_063122213
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 115,676,071 - 115,681,211 (-) NCBI
RefSeq Acc Id:
NP_001102919 ⟸ NM_001109449
- UniProtKB:
Q0VGK3 (UniProtKB/Swiss-Prot), A6I2P3 (UniProtKB/TrEMBL)
- Sequence:
MAAALQVLPCLLRAPSRPFLWGPPVARMTSGMALAEQARQLFDSAVGAVQPGPMLQRTLSLDPSGKQLKVRDRTFQLQENLYLVGFGKAVLGMAAAADELLGQHLVQGVISVPKGIRAAVELAGKQEM
hide sequence
RefSeq Acc Id:
XP_006243919 ⟸ XM_006243857
- Peptide Label:
isoform X1
- UniProtKB:
Q0VGK3 (UniProtKB/Swiss-Prot), A6I2P3 (UniProtKB/TrEMBL)
- Sequence:
MAAALQVLPCLLRAPSRPFLWGPPVARMTSGMALAEQARQLFDSAVGAVQPGPMLQRTLSLDPS
hide sequence
RefSeq Acc Id:
XP_006243918 ⟸ XM_006243856
- Peptide Label:
isoform X1
- UniProtKB:
Q0VGK3 (UniProtKB/Swiss-Prot), A6I2P3 (UniProtKB/TrEMBL)
- Sequence:
MAAALQVLPCLLRAPSRPFLWGPPVARMTSGMALAEQARQLFDSAVGAVQPGPMLQRTLSLDPSGKQLKVRDRTFQLQENLYLVGFGKAVLGMAAAADELLGQHLVQGVISVPKGIRAAVELAGKQEM
hide sequence
Ensembl Acc Id:
ENSRNOP00000064339 ⟸ ENSRNOT00000074595
RefSeq Acc Id:
XP_038938080 ⟸ XM_039082152
- Peptide Label:
isoform X1
- UniProtKB:
Q0VGK3 (UniProtKB/Swiss-Prot), A6I2P3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038938083 ⟸ XM_039082155
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063122212 ⟸ XM_063266142
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063122213 ⟸ XM_063266143
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063122211 ⟸ XM_063266141
- Peptide Label:
isoform X2
RGD ID: 13696241 Promoter ID: EPDNEW_R6766 Type: multiple initiation site Name: Glyctk_1 Description: glycerate kinase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 114,853,140 - 114,853,200 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2010-11-30
Glyctk
glycerate kinase
LOC684314
similar to CG9886-like
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-11-20
LOC684314
similar to CG9886-like
Symbol and Name status set to provisional
70820 PROVISIONAL
