Advanced Search (OLGA)

Gene: Gpn1 (GPN-loop GTPase 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Gpn1

Name:

GPN-loop GTPase 1

RGD ID:

1589985

Description:

Predicted to enable GTPase activity. Predicted to be located in cytosol; mitochondrion; and nucleoplasm. Orthologous to human GPN1 (GPN-loop GTPase 1); INTERACTS WITH 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC688393; LOC688393; similar to XPA binding protein 1; uncharacterized protein LOC688393

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GPN1 (GPN-loop GTPase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Gpn1 (GPN-loop GTPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gpn1 (GPN-loop GTPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GPN1 (GPN-loop GTPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LOC475707 (GPN-loop GTPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gpn1 (GPN-loop GTPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GPN1 (GPN-loop GTPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GPN1 (GPN-loop GTPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gpn1 (GPN-loop GTPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GPN1 (GPN-loop GTPase 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gpn1 (GPN-loop GTPase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gpn1 (GPN-loop GTPase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	NPA3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG3704	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gop-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	30,667,337 - 30,685,011 (-)	NCBI		GRCr8
mRatBN7.2	6	24,947,350 - 24,965,025 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	24,947,325 - 24,965,031 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	25,248,203 - 25,265,877 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	25,564,100 - 25,581,774 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	25,043,316 - 25,060,998 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	26,255,081 - 26,272,755 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	26,242,925 - 26,272,808 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	36,078,631 - 36,096,305 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	25,007,677 - 25,025,341 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	6	24,442,054 - 24,459,728 (-)	NCBI		Celera
Cytogenetic Map	6	q14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gpn1	Rat	Tatton-Brown-Rahman syndrome		ISO	GPN1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Tatton-Brown-Rahman overgrowth syndrome	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gpn1	Rat	Mouth Neoplasms		ISO	GPN1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:27749845

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gpn1	Rat	1,2-dimethylhydrazine	increases expression	ISO	Gpn1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of GPN1 mRNA	CTD	PMID:22206623
Gpn1	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	Gpn1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GPN1 mRNA	CTD	PMID:17942748
Gpn1	Rat	17alpha-ethynylestradiol	increases expression	ISO	Gpn1 (Mus musculus)	6480464	Ethinyl Estradiol results in increased expression of GPN1 mRNA	CTD	PMID:17942748
Gpn1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Gpn1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of GPN1 mRNA	CTD	PMID:21570461
Gpn1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Gpn1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GPN1 mRNA	CTD	PMID:17942748
Gpn1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	GPN1 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin affects the expression of GPN1 mRNA	CTD	PMID:22574217
Gpn1	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	Gpn1 (Mus musculus)	6480464	bisphenol S results in decreased methylation of GPN1 promoter	CTD	PMID:33297965
Gpn1	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of GPN1 mRNA	CTD	PMID:36041667
Gpn1	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	GPN1 (Homo sapiens)	6480464	bisphenol S results in decreased methylation of GPN1 gene	CTD	PMID:31601247
Gpn1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of GPN1 mRNA	CTD	PMID:30047161
Gpn1	Rat	acrylamide	increases expression	ISO	GPN1 (Homo sapiens)	6480464	Acrylamide results in increased expression of GPN1 mRNA	CTD	PMID:32763439
Gpn1	Rat	aflatoxin B1	increases expression	ISO	GPN1 (Homo sapiens)	6480464	Aflatoxin B1 results in increased expression of GPN1 mRNA	CTD	PMID:27153756
Gpn1	Rat	all-trans-retinoic acid	decreases expression	ISO	GPN1 (Homo sapiens)	6480464	Tretinoin results in decreased expression of GPN1 mRNA	CTD	PMID:33167477
Gpn1	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of GPN1 mRNA	CTD	PMID:30047161
Gpn1	Rat	arsenous acid	multiple interactions	ISO	GPN1 (Homo sapiens)	6480464	[Arsenic Trioxide co-treated with Ascorbic Acid] results in decreased expression of GPN1 mRNA	CTD	PMID:25555879
Gpn1	Rat	arsenous acid	decreases expression	ISO	GPN1 (Homo sapiens)	6480464	Arsenic Trioxide results in decreased expression of GPN1 mRNA	CTD	PMID:25555879
Gpn1	Rat	benzo[a]pyrene	increases expression	ISO	Gpn1 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of GPN1 mRNA	CTD	PMID:22228805
Gpn1	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Gpn1 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of GPN1 mRNA	CTD	PMID:34319233
Gpn1	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of GPN1 mRNA	CTD	PMID:25181051
Gpn1	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of GPN1 mRNA	CTD	PMID:36041667
Gpn1	Rat	bisphenol A	multiple interactions	ISO	GPN1 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of GPN1 gene	CTD	PMID:31601247
Gpn1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of GPN1 mRNA	CTD	PMID:30816183 and PMID:32528016
Gpn1	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of GPN1 gene	CTD	PMID:28505145
Gpn1	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of GPN1 mRNA	CTD	PMID:36041667
Gpn1	Rat	cadmium dichloride	increases expression	EXP		6480464	Cadmium Chloride results in increased expression of GPN1 mRNA	CTD	PMID:33453195
Gpn1	Rat	chloropicrin	increases expression	ISO	GPN1 (Homo sapiens)	6480464	chloropicrin results in increased expression of GPN1 mRNA	CTD	PMID:26352163
Gpn1	Rat	chlorpyrifos	decreases expression	ISO	Gpn1 (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of GPN1 mRNA	CTD	PMID:37019170
Gpn1	Rat	chromium(6+)	affects expression	ISO	Gpn1 (Mus musculus)	6480464	chromium hexavalent ion affects the expression of GPN1 mRNA	CTD	PMID:28472532
Gpn1	Rat	copper(II) sulfate	increases expression	ISO	GPN1 (Homo sapiens)	6480464	Copper Sulfate results in increased expression of GPN1 mRNA	CTD	PMID:19549813
Gpn1	Rat	cyclosporin A	increases expression	ISO	GPN1 (Homo sapiens)	6480464	Cyclosporine results in increased expression of GPN1 mRNA	CTD	PMID:20106945 and PMID:25562108
Gpn1	Rat	deoxynivalenol	increases phosphorylation	ISO	Gpn1 (Mus musculus)	6480464	deoxynivalenol results in increased phosphorylation of GPN1 protein	CTD	PMID:23352502
Gpn1	Rat	diarsenic trioxide	decreases expression	ISO	GPN1 (Homo sapiens)	6480464	Arsenic Trioxide results in decreased expression of GPN1 mRNA	CTD	PMID:25555879
Gpn1	Rat	diarsenic trioxide	multiple interactions	ISO	GPN1 (Homo sapiens)	6480464	[Arsenic Trioxide co-treated with Ascorbic Acid] results in decreased expression of GPN1 mRNA	CTD	PMID:25555879
Gpn1	Rat	dibutyl phthalate	decreases expression	ISO	Gpn1 (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of GPN1 mRNA	CTD	PMID:17361019 and PMID:21266533
Gpn1	Rat	dicrotophos	decreases expression	ISO	GPN1 (Homo sapiens)	6480464	dicrotophos results in decreased expression of GPN1 mRNA	CTD	PMID:28302478
Gpn1	Rat	doxorubicin	decreases expression	ISO	GPN1 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of GPN1 mRNA	CTD	PMID:29803840
Gpn1	Rat	epoxiconazole	decreases expression	ISO	Gpn1 (Mus musculus)	6480464	epoxiconazole results in decreased expression of GPN1 mRNA	CTD	PMID:35436446
Gpn1	Rat	FR900359	increases phosphorylation	ISO	GPN1 (Homo sapiens)	6480464	FR900359 results in increased phosphorylation of GPN1 protein	CTD	PMID:37730182
Gpn1	Rat	fulvestrant	multiple interactions	ISO	GPN1 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of GPN1 gene	CTD	PMID:31601247
Gpn1	Rat	ivermectin	decreases expression	ISO	GPN1 (Homo sapiens)	6480464	Ivermectin results in decreased expression of GPN1 protein	CTD	PMID:32959892
Gpn1	Rat	L-ascorbic acid	multiple interactions	ISO	GPN1 (Homo sapiens)	6480464	[arsenic trioxide co-treated with Ascorbic Acid] results in decreased expression of GPN1 mRNA	CTD	PMID:25555879
Gpn1	Rat	L-ascorbic acid	decreases expression	ISO	GPN1 (Homo sapiens)	6480464	Ascorbic Acid results in decreased expression of GPN1 mRNA	CTD	PMID:25555879
Gpn1	Rat	lead(0)	affects expression	ISO	GPN1 (Homo sapiens)	6480464	Lead affects the expression of GPN1 mRNA	CTD	PMID:28903495
Gpn1	Rat	paracetamol	affects expression	ISO	Gpn1 (Mus musculus)	6480464	Acetaminophen affects the expression of GPN1 mRNA	CTD	PMID:17562736
Gpn1	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of GPN1 mRNA	CTD	PMID:33387578
Gpn1	Rat	propiconazole	increases expression	EXP		6480464	propiconazole results in increased expression of GPN1 mRNA	CTD	PMID:30047161
Gpn1	Rat	quercetin	decreases expression	ISO	GPN1 (Homo sapiens)	6480464	Quercetin results in decreased expression of GPN1 mRNA	CTD	PMID:21632981
Gpn1	Rat	resveratrol	multiple interactions	ISO	GPN1 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of GPN1 mRNA	CTD	PMID:23557933
Gpn1	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of GPN1 mRNA	CTD	PMID:30047161
Gpn1	Rat	titanium dioxide	decreases methylation	ISO	Gpn1 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of GPN1 gene	CTD	PMID:35295148
Gpn1	Rat	urethane	decreases expression	ISO	GPN1 (Homo sapiens)	6480464	Urethane results in decreased expression of GPN1 mRNA	CTD	PMID:28818685
Gpn1	Rat	valproic acid	affects expression	ISO	GPN1 (Homo sapiens)	6480464	Valproic Acid affects the expression of GPN1 mRNA	CTD	PMID:25979313
Gpn1	Rat	valproic acid	decreases expression	ISO	GPN1 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of GPN1 mRNA	CTD	PMID:23179753 and PMID:27188386

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gpn1	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gpn1	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Gpn1	Rat	cytosol	located_in	IEA	UniProtKB:Q53RZ9 and ensembl:ENSP00000476446	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gpn1	Rat	cytosol	located_in	ISO	GPN1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Gpn1	Rat	cytosol	located_in	IEA	UniProtKB:Q9HCN4 and ensembl:ENSP00000476446	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gpn1	Rat	mitochondrion	located_in	IEA	UniProtKB:Q53RZ9 and ensembl:ENSP00000476446	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gpn1	Rat	mitochondrion	located_in	ISO	GPN1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Gpn1	Rat	mitochondrion	located_in	IEA	UniProtKB:Q9HCN4 and ensembl:ENSP00000476446	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gpn1	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q9HCN4 and ensembl:ENSP00000476446	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gpn1	Rat	nucleoplasm	located_in	ISO	GPN1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Gpn1	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q53RZ9 and ensembl:ENSP00000476446	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gpn1	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gpn1	Rat	GTP binding	enables	IEA	UniProtKB-KW:KW-0342	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gpn1	Rat	GTPase activity	enables	IEA	InterPro:IPR030230	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gpn1	Rat	GTPase activity	enables	IBA	PANTHER:PTN000477654 and SGD:S000003833	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gpn1	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gpn1	Rat	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gpn1	Rat	protein binding	enables	ISO	GPN1 (Homo sapiens)	1624291	UniProtKB:Q8IXW5 more ...	RGD	PMID:24981860 more ...

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932

Gpn1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	30,667,337 - 30,685,011 (-)	NCBI		GRCr8
mRatBN7.2	6	24,947,350 - 24,965,025 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	24,947,325 - 24,965,031 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	25,248,203 - 25,265,877 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	25,564,100 - 25,581,774 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	25,043,316 - 25,060,998 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	26,255,081 - 26,272,755 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	26,242,925 - 26,272,808 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	36,078,631 - 36,096,305 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	25,007,677 - 25,025,341 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	6	24,442,054 - 24,459,728 (-)	NCBI		Celera
Cytogenetic Map	6	q14	NCBI

GPN1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	27,628,247 - 27,651,511 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	27,628,247 - 27,651,511 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	27,851,114 - 27,874,378 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	27,705,407 - 27,727,217 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	27,763,553 - 27,785,364	NCBI
Celera	2	27,696,971 - 27,719,184 (+)	NCBI		Celera
Cytogenetic Map	2	p23.3	NCBI
HuRef	2	27,593,161 - 27,614,669 (+)	NCBI		HuRef
CHM1_1	2	27,782,251 - 27,804,452 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	27,671,332 - 27,694,600 (+)	NCBI		T2T-CHM13v2.0

Gpn1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	31,652,085 - 31,670,250 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	31,652,085 - 31,670,248 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	31,494,741 - 31,512,904 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	31,494,741 - 31,512,904 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	31,797,134 - 31,814,000 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	31,771,342 - 31,788,208 (+)	NCBI		MGSCv36	mm8
Celera	5	28,973,514 - 28,990,516 (+)	NCBI		Celera
Cytogenetic Map	5	B1	NCBI
cM Map	5	17.27	NCBI

Gpn1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955469	9,580,118 - 9,601,696 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955469	9,580,068 - 9,602,575 (+)	NCBI	ChiLan1.0	ChiLan1.0

GPN1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	98,865,384 - 98,887,321 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	98,869,353 - 98,891,290 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	27,626,795 - 27,648,753 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	27,713,044 - 27,734,791 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	27,712,850 - 27,734,795 (+)	Ensembl	panpan1.1		panPan2

LOC475707
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	21,654,516 - 21,678,435 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	21,545,673 - 21,673,157 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	21,449,223 - 21,473,141 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	22,214,314 - 22,233,113 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	21,927,181 - 21,980,004 (+)	Ensembl		ROS_Cfam_1.0 Ensembl

Gpn1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	65,847,040 - 65,868,276 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936493	4,972,592 - 4,992,471 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936493	4,971,289 - 4,992,526 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GPN1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	111,537,737 - 111,572,692 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	111,541,010 - 111,565,065 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	118,507,937 - 118,531,394 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GPN1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	79,979,107 - 80,006,630 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	79,979,796 - 80,007,382 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	32,150,189 - 32,171,209 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gpn1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624738	9,645,250 - 9,676,372 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624738	9,645,531 - 9,673,388 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Gpn1
99 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	87
Count of miRNA genes:	72
Interacting mature miRNAs:	85
Transcripts:	ENSRNOT00000006599
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8552962	Pigfal16	Plasma insulin-like growth factor 1 level QTL 16	9.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	6	1	41223769	Rat
1549905	Stresp10	Stress response QTL 10	6.83	0.0066	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	6	1	27574569	Rat
10401812	Kidm54	Kidney mass QTL 54			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	14368788	59368788	Rat
1331743	Uae28	Urinary albumin excretion QTL 28	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	1	34235784	Rat
2292589	Emca10	Estrogen-induced mammary cancer QTL 10		0.048	mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	6	16536140	61536140	Rat
10401800	Kidm49	Kidney mass QTL 49			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	14368788	59368788	Rat
1300164	Rf15	Renal function QTL 15	3.12		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	54641141	Rat
9589129	Insul24	Insulin level QTL 24	19.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	6	1	41223769	Rat
1578758	Tcas9	Tongue tumor susceptibility QTL 9	3.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	6	1	37618905	Rat
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
7411603	Foco13	Food consumption QTL 13	5.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	41223769	Rat
1598843	Cm63	Cardiac mass QTL 63	2.6		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	1	39036266	Rat
738024	Sach5	Saccharine consumption QTL 5	3.9	0.00039	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	6	1	43394190	Rat
7411542	Bw127	Body weight QTL 127	5.5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	1	41223769	Rat
9589048	Scfw3	Subcutaneous fat weight QTL 3	4.57	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	6	1	41223769	Rat
738023	Alc17	Alcohol consumption QTL 17	3.1	0.003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	6	1	27574569	Rat
1354616	Despr12	Despair related QTL 12		0.0012	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	6	1	27574569	Rat
2293839	Kiddil2	Kidney dilation QTL 2	4.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	20866422	81133036	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat
2293709	Bss23	Bone structure and strength QTL 23	5.18	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	6	1	42487980	Rat
2293650	Bss31	Bone structure and strength QTL 31	5.05	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	6	1	42487980	Rat
7411584	Foco4	Food consumption QTL 4	4.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	42838846	Rat
1578665	Bss16	Bone structure and strength QTL 16	4.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	6	11735669	72593685	Rat
2293841	Kiddil4	Kidney dilation QTL 4	4.4		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	20866422	81133036	Rat
2300176	Bmd51	Bone mineral density QTL 51	11.7	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	6	1	27574569	Rat
1300128	Rf16	Renal function QTL 16	3.89		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	34434305	Rat
1641898	Colcr4	Colorectal carcinoma resistance QTL4	3.71	0.0007	intestine integrity trait (VT:0010554)	well differentiated malignant colorectal tumor surface area measurement (CMO:0002077)	6	20338777	62613667	Rat
1578668	Bmd14	Bone mineral density QTL 14	3.8		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	6	11735669	72593685	Rat
2301972	Bp325	Blood pressure QTL 325	4.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	1	72227641	Rat
2293656	Bss28	Bone structure and strength QTL 28	6.79	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	6	1	42487980	Rat
1359023	Bp272	Blood pressure QTL 272	2.5		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	16536140	27261739	Rat
1354664	Slep2	Serum leptin concentration QTL 2	4.49		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	6	16536140	71636405	Rat
2300190	Bmd52	Bone mineral density QTL 52	11.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	6	1	27574569	Rat

RH142886

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	24,950,560 - 24,950,773 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	26,258,292 - 26,258,504	NCBI	Rnor6.0
Rnor_5.0	6	36,081,842 - 36,082,054	UniSTS	Rnor5.0
RGSC_v3.4	6	25,010,888 - 25,011,100	UniSTS	RGSC3.4
Celera	6	24,445,265 - 24,445,477	UniSTS
RH 3.4 Map	1	1469.4	UniSTS
Cytogenetic Map	6	q13	UniSTS

RH141718

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	24,947,575 - 24,947,777 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	26,255,307 - 26,255,508	NCBI	Rnor6.0
Rnor_5.0	6	36,078,857 - 36,079,058	UniSTS	Rnor5.0
RGSC_v3.4	6	25,007,903 - 25,008,104	UniSTS	RGSC3.4
Celera	6	24,442,280 - 24,442,481	UniSTS
RH 3.4 Map	6	88.9	UniSTS
Cytogenetic Map	6	q13	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001127572	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC161949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006599 ⟹ ENSRNOP00000006599

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	24,947,325 - 24,965,029 (-)	Ensembl
Rnor_6.0 Ensembl	6	26,255,083 - 26,272,755 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000087938 ⟹ ENSRNOP00000069978

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	24,949,143 - 24,965,026 (-)	Ensembl
Rnor_6.0 Ensembl	6	26,242,925 - 26,272,808 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096087 ⟹ ENSRNOP00000090133

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	24,947,353 - 24,965,031 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112509 ⟹ ENSRNOP00000097971

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	24,947,352 - 24,965,019 (-)	Ensembl

RefSeq Acc Id:

NM_001127572 ⟹ NP_001121044

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	30,667,337 - 30,685,011 (-)	NCBI
mRatBN7.2	6	24,947,350 - 24,965,025 (-)	NCBI
Rnor_6.0	6	26,255,081 - 26,272,755 (-)	NCBI
Rnor_5.0	6	36,078,631 - 36,096,305 (-)	NCBI
RGSC_v3.4	6	25,007,677 - 25,025,341 (-)	RGD
Celera	6	24,442,054 - 24,459,728 (-)	RGD

Sequence:

show sequence

GGCGTGGCTGAGGAAAGATGGCGGCGCCCGCGGCTCCTGCCGAGCCCCAGGCTTCCGGGGCTCCGGAGCTCCCCGTGTGTCTGTTGGTGTTGGGAATGGCGGGATCCGGGAAAACTACCTTTGTACAG
AGGCTCACAGGACACCTGCACAACAAAGGCTGTCCACCATATGTAATCAATCTGGACCCGGCTGTGCATGAAGTCCCTTTTCCCGCCAATATTGATATTCGAGACACAGTGAAGTACAAAGAAGTCAT
GAAGCAATATGGACTTGGGCCAAACGGCGGCATAGTGACCTCCCTCAACCTCTTCGCTACCAGGTTTGATCAGGTGATGAAATTTATTGAGAAGGCCCAGAACACATTCAGATATGTCTTGATTGACA
CACCCGGACAGATTGAAGTATTTACCTGGTCAGCTTCGGGGACAATCATCACTGAGGCCCTGGCATCCTCCTTTCCAACAGTGGTCATCTATGTCATGGACACGTCTCGGAGCACTAACCCAGTGACC
TTCATGTCCAATATGCTTTATGCATGCAGCATCTTGTACAAAACCAAGCTGCCTTTCATTGTGGTCATGAACAAAACGGACATCATTGACCACAGCTTTGCAGTCGAGTGGATGCAGGATTTTGAGGC
TTTCCAGGATGCCTTGAACCAAGAGACGACCTACGTCAGTAACCTGACTCGTTCCATGAGCCTGGTGTTAGATGAGTTCTACAGCTCACTCAGGGTGGTGGGTGTCTCTGCTGTGGTGGGCACCGGCT
TCGATGAACTCTGTGCTCAGGTCACCAGTGCTGCAGAGGAGTACGAAAGGGAATATCGTCCTGAATATGAGCGTCTGAAGAAATCACTGGCCAGTGCCCAGAGTAATGAGCAGAAGGAGCAACTAGAG
CGTCTTCGGAAGGACATGGGCTCCATAGCCCTGGACCCAGGGGCCAGCACAGACGGTGCATCTCCTGTGCTGGACCCTTCTGACTTGATCCTGACTCGAGGAACCTTGGATGAGGAGGATGAGGAAGC
CGACAGTGACACTGACGACATTGATCACCGAGTTACAGAGGAAAGCCGTGAAGAGCCAGCGTTCCAGAACTTCATGCAGGAATCAATCGCACAGCACTGGAAGAGAAACAAGTAGGCCCCCCTCCCAC
ACGCTGCAGGGGTCTATGTGCTGGGTCTCCATGCAGAGGACATCCTTTGTGAACCAGGGCTGCAGTCCAGAGCAGTCTCCTCCCAGCTGCTGACTTCTTTGAGGGAACCTGGACTCAGATGAAGTCTG
GTTGAAGGTGGAGCTGGCAGGTAGATCTCATCCTTGGGTAGCTTCCCCCAGTGTTTATGCAAGGAGGTCTCACTGCTCTGCCAGCTGATAACTGTTCAGCCTACAACTTCAAGTCGAATCGTTTGAAC
TCAAGTGTTTTGCTGCTGATGGGACAGAGGGAACTTTGGATCTTGACGAGCAGGATCTGTGGACATTGCCTCCTTAGCACTGTGCTCCCGACTCTGCACCCCAAGCTGCTGTTCTTTAAGCAGAATGG
GAAGGGAGAATGCATTTGTACAGCGGGTGGCGAGTGCCCTTGGCAGCCAGGTCTGATGTCATCTGTGCTCACACAAGGTAGCACATTTTCAAGAGTGTTGTTTGAATGGTGACTTGGATAAAGATTTA
ACTTTAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001121044	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI61949	(Get FASTA)	NCBI Sequence Viewer
	EDM02907	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006599.6
	ENSRNOP00000069978.2
	ENSRNOP00000090133
	ENSRNOP00000090133.1
	ENSRNOP00000097971.1

RefSeq Acc Id:

NP_001121044 ⟸ NM_001127572

- UniProtKB:

B1WBZ7 (UniProtKB/TrEMBL), E9PT96 (UniProtKB/TrEMBL), A0A9K3Y7D6 (UniProtKB/TrEMBL), A0A8I6ATM7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAPAAPAEPQASGAPELPVCLLVLGMAGSGKTTFVQRLTGHLHNKGCPPYVINLDPAVHEVPFPANIDIRDTVKYKEVMKQYGLGPNGGIVTSLNLFATRFDQVMKFIEKAQNTFRYVLIDTPGQIE
VFTWSASGTIITEALASSFPTVVIYVMDTSRSTNPVTFMSNMLYACSILYKTKLPFIVVMNKTDIIDHSFAVEWMQDFEAFQDALNQETTYVSNLTRSMSLVLDEFYSSLRVVGVSAVVGTGFDELCA
QVTSAAEEYEREYRPEYERLKKSLASAQSNEQKEQLERLRKDMGSIALDPGASTDGASPVLDPSDLILTRGTLDEEDEEADSDTDDIDHRVTEESREEPAFQNFMQESIAQHWKRNK

hide sequence

Ensembl Acc Id:

ENSRNOP00000006599 ⟸ ENSRNOT00000006599

Ensembl Acc Id:

ENSRNOP00000069978 ⟸ ENSRNOT00000087938

Ensembl Acc Id:

ENSRNOP00000090133 ⟸ ENSRNOT00000096087

Ensembl Acc Id:

ENSRNOP00000097971 ⟸ ENSRNOT00000112509

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B1WBZ7-F1-model_v2	AlphaFold	B1WBZ7	1-373	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13694434

Promoter ID:

EPDNEW_R4958

Type:

multiple initiation site

Name:

Gpn1_1

Description:

GPN-loop GTPase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	26,272,749 - 26,272,809	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-38363	BioCyc
Ensembl Genes	ENSRNOG00000004941	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000006599.7	UniProtKB/TrEMBL
	ENSRNOT00000087938.2	UniProtKB/TrEMBL
	ENSRNOT00000096087	ENTREZGENE
	ENSRNOT00000096087.1	UniProtKB/TrEMBL
	ENSRNOT00000112509.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.300	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:9025530	IMAGE-MGC_LOAD
InterPro	Gpn1/Npa3/XAB1	UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/TrEMBL
	Uncharacterised_ATP-bd	UniProtKB/TrEMBL
KEGG Report	rno:688393	UniProtKB/TrEMBL
MGC_CLONE	MGC:187742	IMAGE-MGC_LOAD
NCBI Gene	688393	ENTREZGENE
PANTHER	PTHR21231	UniProtKB/TrEMBL
	PTHR21231:SF8	UniProtKB/TrEMBL
Pfam	ATP_bind_1	UniProtKB/TrEMBL
PhenoGen	Gpn1	PhenoGen
RatGTEx	ENSRNOG00000004941	RatGTEx
Superfamily-SCOP	SSF52540	UniProtKB/TrEMBL
UniProt	A0A0G2JWR0_RAT	UniProtKB/TrEMBL
	A0A8I6ADU4_RAT	UniProtKB/TrEMBL
	A0A8I6ATM7	ENTREZGENE, UniProtKB/TrEMBL
	A0A9K3Y7D6	ENTREZGENE, UniProtKB/TrEMBL
	B1WBZ7	ENTREZGENE, UniProtKB/TrEMBL
	E9PT96	ENTREZGENE
UniProt Secondary	E9PT96	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-10-02	Gpn1	GPN-loop GTPase 1	LOC688393	similar to XPA binding protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	LOC688393	similar to XPA binding protein 1	LOC683898	similar to XPA binding protein 1	Data merged from RGD:1597784	1643240	APPROVED
2006-11-20	LOC688393	similar to XPA binding protein 1			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC683898	similar to XPA binding protein 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD