Advanced Search (OLGA)

Gene: Alkbh6 (alkB homolog 6) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Alkbh6

Name:

alkB homolog 6

RGD ID:

1566318

Description:

Predicted to enable metal ion binding activity. Predicted to be located in focal adhesion and nucleoplasm. Predicted to be active in nucleus. Orthologous to human ALKBH6 (alkB homolog 6); INTERACTS WITH 1,3-dinitrobenzene; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

alkB, alkylation repair homolog 6; alkB, alkylation repair homolog 6 (E. coli); alkylated DNA repair protein alkB homolog 6; alpha-ketoglutarate-dependent dioxygenase alkB homolog 6; LOC108348106; LOC292780; MGC112693; probable alpha-ketoglutarate-dependent dioxygenase ABH6; similar to hypothetical protein MGC15677

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ALKBH6 (alkB homolog 6)	HGNC	Ensembl, Inparanoid, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Alkbh6 (alkB homolog 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Alkbh6 (alkB homolog 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ALKBH6 (alkB homolog 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ALKBH6 (alkB homolog 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Alkbh6 (alkB homolog 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ALKBH6 (alkB homolog 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ALKBH6 (alkB homolog 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Alkbh6 (alkB homolog 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ALKBH6 (alkB homolog 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Alkbh6 (alkB homolog 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	alkbh6 (alkB homolog 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	B0564.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6144	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	alkbh6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	94,690,979 - 94,696,429 (+)	NCBI		GRCr8
mRatBN7.2	1	85,563,511 - 85,568,977 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	85,563,592 - 85,568,973 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	90,979,724 - 90,985,119 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	99,447,940 - 99,453,284 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	92,737,985 - 92,743,380 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	88,766,872 - 88,772,243 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	88,766,872 - 88,772,242 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	1	90,957,133 - 90,962,466 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	92,094,314 - 92,099,684 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	85,255,190 - 85,260,560 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	79,937,451 - 79,942,812 (+)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Alkbh6	Rat	Brugada syndrome 5		ISO	ALKBH6 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Brugada syndrome 5	ClinVar	PMID:28492532
Alkbh6	Rat	hereditary spastic paraplegia 75		ISO	ALKBH6 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary spastic paraplegia 75	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Alkbh6	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Alkbh6 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ALKBH6 mRNA	CTD	PMID:36331819
Alkbh6	Rat	1,3-dinitrobenzene	increases expression	EXP		6480464	3-dinitrobenzene results in increased expression of ALKBH6 mRNA	CTD	PMID:21983209
Alkbh6	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Alkbh6 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of ALKBH6 mRNA	CTD	PMID:24680724
Alkbh6	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of ALKBH6 mRNA	CTD	PMID:33387578
Alkbh6	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of ALKBH6 mRNA	CTD	PMID:24780913 and PMID:30047161
Alkbh6	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of ALKBH6 mRNA	CTD	PMID:30047161
Alkbh6	Rat	antirheumatic drug	decreases expression	ISO	ALKBH6 (Homo sapiens)	6480464	Antirheumatic Agents results in decreased expression of ALKBH6 mRNA	CTD	PMID:24449571
Alkbh6	Rat	benzo[a]pyrene	increases methylation	ISO	ALKBH6 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of ALKBH6 3' UTR	CTD	PMID:27901495
Alkbh6	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of ALKBH6 mRNA	CTD	PMID:25181051 and PMID:36779543
Alkbh6	Rat	bisphenol A	decreases expression	ISO	Alkbh6 (Mus musculus)	6480464	bisphenol A results in decreased expression of ALKBH6 mRNA	CTD	PMID:35598803
Alkbh6	Rat	bisphenol F	decreases expression	ISO	Alkbh6 (Mus musculus)	6480464	bisphenol F results in decreased expression of ALKBH6 mRNA	CTD	PMID:38685157
Alkbh6	Rat	cadmium dichloride	decreases expression	ISO	ALKBH6 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of ALKBH6 mRNA	CTD	PMID:38568856
Alkbh6	Rat	chlorpyrifos	increases expression	ISO	Alkbh6 (Mus musculus)	6480464	Chlorpyrifos results in increased expression of ALKBH6 mRNA	CTD	PMID:37019170
Alkbh6	Rat	dibutyl phthalate	decreases expression	ISO	Alkbh6 (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of ALKBH6 mRNA	CTD	PMID:21266533
Alkbh6	Rat	diethylstilbestrol	increases expression	EXP		6480464	Diethylstilbestrol results in increased expression of ALKBH6 mRNA	CTD	PMID:36653537
Alkbh6	Rat	disodium selenite	increases expression	ISO	ALKBH6 (Homo sapiens)	6480464	Sodium Selenite results in increased expression of ALKBH6 mRNA	CTD	PMID:18175754
Alkbh6	Rat	doxorubicin	decreases expression	ISO	ALKBH6 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of ALKBH6 mRNA	CTD	PMID:29803840
Alkbh6	Rat	epoxiconazole	decreases expression	ISO	Alkbh6 (Mus musculus)	6480464	epoxiconazole results in decreased expression of ALKBH6 mRNA	CTD	PMID:35436446
Alkbh6	Rat	methyl methanesulfonate	increases expression	ISO	ALKBH6 (Homo sapiens)	6480464	Methyl Methanesulfonate results in increased expression of ALKBH6 mRNA	CTD	PMID:23649840
Alkbh6	Rat	paracetamol	affects expression	ISO	Alkbh6 (Mus musculus)	6480464	Acetaminophen affects the expression of ALKBH6 mRNA	CTD	PMID:17562736
Alkbh6	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of ALKBH6 mRNA	CTD	PMID:33387578
Alkbh6	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Alkbh6 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ALKBH6 mRNA	CTD	PMID:36331819
Alkbh6	Rat	propiconazole	increases expression	EXP		6480464	propiconazole results in increased expression of ALKBH6 mRNA	CTD	PMID:30047161
Alkbh6	Rat	Soman	decreases expression	EXP		6480464	Soman results in decreased expression of ALKBH6 mRNA	CTD	PMID:19281266
Alkbh6	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of ALKBH6 mRNA	CTD	PMID:30047161
Alkbh6	Rat	sunitinib	decreases expression	ISO	ALKBH6 (Homo sapiens)	6480464	Sunitinib results in decreased expression of ALKBH6 mRNA	CTD	PMID:31533062
Alkbh6	Rat	triadimefon	increases expression	EXP		6480464	triadimefon results in increased expression of ALKBH6 mRNA	CTD	PMID:30047161
Alkbh6	Rat	urethane	decreases expression	ISO	ALKBH6 (Homo sapiens)	6480464	Urethane results in decreased expression of ALKBH6 mRNA	CTD	PMID:28818685
Alkbh6	Rat	valproic acid	increases expression	ISO	ALKBH6 (Homo sapiens)	6480464	Valproic Acid results in increased expression of ALKBH6 mRNA	CTD	PMID:23179753

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Alkbh6	Rat	focal adhesion	located_in	IEA	UniProtKB:Q3KRA9 and ensembl:ENSP00000368152	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Alkbh6	Rat	focal adhesion	located_in	ISO	ALKBH6 (Homo sapiens) and UniProtKB:Q3KRA9-1	1624291		RGD	GO_REF:0000052
Alkbh6	Rat	nucleoplasm	located_in	ISO	ALKBH6 (Homo sapiens) and UniProtKB:Q3KRA9-1	1624291		RGD	GO_REF:0000052
Alkbh6	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q3KRA9 and ensembl:ENSP00000368152	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Alkbh6	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Alkbh6	Rat	nucleus	is_active_in	IBA	PANTHER:PTN000990957 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Alkbh6	Rat	2-oxoglutarate-dependent dioxygenase activity	NOT\|enables	ISO	Alkbh6 (Mus musculus)	1624291	PMID:16174769	RGD	PMID:16174769
Alkbh6	Rat	dioxygenase activity	enables	IEA	UniProtKB-KW:KW-0223	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Alkbh6	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Alkbh6	Rat	protein binding	enables	ISO	ALKBH6 (Homo sapiens)	1624291	UniProtKB:Q9H867 and PMID:22948820	RGD	PMID:22948820

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

PMID:16174769

Alkbh6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	94,690,979 - 94,696,429 (+)	NCBI		GRCr8
mRatBN7.2	1	85,563,511 - 85,568,977 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	85,563,592 - 85,568,973 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	90,979,724 - 90,985,119 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	99,447,940 - 99,453,284 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	92,737,985 - 92,743,380 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	88,766,872 - 88,772,243 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	88,766,872 - 88,772,242 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	1	90,957,133 - 90,962,466 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	92,094,314 - 92,099,684 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	85,255,190 - 85,260,560 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	79,937,451 - 79,942,812 (+)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

ALKBH6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	36,009,120 - 36,014,239 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	36,009,120 - 36,014,239 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	36,500,022 - 36,505,141 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	41,191,862 - 41,196,981 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	19	33,214,202 - 33,219,321 (-)	NCBI		Celera
Cytogenetic Map	19	q13.12	NCBI
HuRef	19	33,005,571 - 33,010,690 (-)	NCBI		HuRef
CHM1_1	19	36,501,371 - 36,506,490 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	38,554,919 - 38,560,038 (-)	NCBI		T2T-CHM13v2.0

Alkbh6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	30,008,178 - 30,013,728 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	30,008,142 - 30,013,729 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	30,308,753 - 30,314,303 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	30,308,717 - 30,314,304 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	31,093,772 - 31,099,322 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	30,017,513 - 30,023,063 (+)	NCBI		MGSCv36	mm8
Celera	7	24,904,872 - 24,910,436 (+)	NCBI		Celera
Cytogenetic Map	7	B1	NCBI
cM Map	7	17.38	NCBI

Alkbh6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	2,575,568 - 2,582,032 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955468	2,575,469 - 2,580,632 (+)	NCBI	ChiLan1.0	ChiLan1.0

ALKBH6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	42,010,025 - 42,015,162 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	43,993,666 - 43,998,802 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	32,927,382 - 32,932,519 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	41,675,899 - 41,681,015 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	41,675,899 - 41,681,015 (-)	Ensembl	panpan1.1		panPan2

ALKBH6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	116,671,147 - 116,676,784 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	116,670,841 - 116,680,515 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	116,076,834 - 116,082,479 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	117,274,284 - 117,279,932 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	117,274,286 - 117,279,361 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	116,838,319 - 116,843,973 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	116,461,885 - 116,467,539 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	117,517,091 - 117,522,745 (+)	NCBI		UU_Cfam_GSD_1.0

Alkbh6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	11,274,066 - 11,279,691 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936922	44,807 - 49,834 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936922	44,201 - 49,792 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ALKBH6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	45,384,957 - 45,390,244 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	45,384,955 - 45,390,247 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	40,787,631 - 40,792,954 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ALKBH6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	30,920,192 - 30,925,659 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	30,920,185 - 30,925,362 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	8,715,150 - 8,720,323 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Alkbh6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	10,271,116 - 10,274,845 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla_female_1.0 Ensembl	NW_004624794	10,275,555 - 10,280,725 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624794	10,271,107 - 10,281,055 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Alkbh6
83 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	180
Count of miRNA genes:	84
Interacting mature miRNAs:	89
Transcripts:	ENSRNOT00000051259, ENSRNOT00000071180
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	85424647	100358001	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	72197680	90508767	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	82174743	118944897	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889494	Scort2	Serum corticosterone level QTL 2	4.2		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	80592172	125592172	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514)	1	83547917	128547917	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	78430754	91209302	Rat

AI844915

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	85,563,010 - 85,563,149 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	85,563,010 - 85,563,149 (-)	MAPPER	mRatBN7.2
Rnor_6.0	1	88,766,277 - 88,766,415	NCBI	Rnor6.0
Rnor_6.0	1	90,962,959 - 90,963,097	NCBI	Rnor6.0
Rnor_5.0	1	92,100,141 - 92,100,279	UniSTS	Rnor5.0
Rnor_5.0	1	89,922,295 - 89,922,433	UniSTS	Rnor5.0
RGSC_v3.4	1	85,254,595 - 85,254,733	UniSTS	RGSC3.4
Celera	1	79,936,856 - 79,936,994	UniSTS
Cytogenetic Map	1	q21	UniSTS

AI044262

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	85,562,964 - 85,563,151 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	85,562,964 - 85,563,151 (-)	MAPPER	mRatBN7.2
Rnor_6.0	1	90,962,957 - 90,963,143	NCBI	Rnor6.0
Rnor_6.0	1	88,766,231 - 88,766,417	NCBI	Rnor6.0
Rnor_5.0	1	89,922,249 - 89,922,435	UniSTS	Rnor5.0
Rnor_5.0	1	92,100,139 - 92,100,325	UniSTS	Rnor5.0
RGSC_v3.4	1	85,254,549 - 85,254,735	UniSTS	RGSC3.4
Celera	1	79,936,810 - 79,936,996	UniSTS
RH 3.4 Map	1	882.29	UniSTS
Cytogenetic Map	1	q21	UniSTS

UniSTS:235641

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	85,562,890 - 85,563,026 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	85,562,890 - 85,563,026 (-)	MAPPER	mRatBN7.2
Rnor_6.0	1	88,766,157 - 88,766,292	NCBI	Rnor6.0
Rnor_6.0	1	90,963,082 - 90,963,217	NCBI	Rnor6.0
Rnor_5.0	1	92,100,264 - 92,100,399	UniSTS	Rnor5.0
Rnor_5.0	1	89,922,175 - 89,922,310	UniSTS	Rnor5.0
RGSC_v3.4	1	85,254,475 - 85,254,610	UniSTS	RGSC3.4
Celera	1	79,936,736 - 79,936,871	UniSTS
Cytogenetic Map	1	q21	UniSTS

CLIPR-59__4586

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	85,562,383 - 85,563,184 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	85,562,383 - 85,563,184 (-)	MAPPER	mRatBN7.2
Rnor_6.0	1	88,765,650 - 88,766,450	NCBI	Rnor6.0
Rnor_6.0	1	90,962,924 - 90,963,724	NCBI	Rnor6.0
Rnor_5.0	1	92,100,106 - 92,100,906	UniSTS	Rnor5.0
Rnor_5.0	1	89,921,668 - 89,922,468	UniSTS	Rnor5.0
RGSC_v3.4	1	85,253,968 - 85,254,768	UniSTS	RGSC3.4
Celera	1	79,936,229 - 79,937,029	UniSTS
Cytogenetic Map	1	q21	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
6	19	84	155	99	104	67	38	67	299	144	139	69	79	37


RefSeq Transcripts	NM_001127450	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104487	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283620	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005501802	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC082048	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098707	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB581428	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000051259 ⟹ ENSRNOP00000043754

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	85,563,592 - 85,568,973 (+)	Ensembl
Rnor_6.0 Ensembl	1	88,766,872 - 88,772,242 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000071180 ⟹ ENSRNOP00000064657

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	1	90,957,261 - 90,961,717 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000080613 ⟹ ENSRNOP00000072260

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	85,563,592 - 85,568,973 (+)	Ensembl
Rnor_6.0 Ensembl	1	90,957,133 - 90,962,466 (-)	Ensembl

RefSeq Acc Id:

NM_001127450 ⟹ NP_001120922

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	94,691,062 - 94,696,429 (+)	NCBI
mRatBN7.2	1	85,563,606 - 85,568,973 (+)	NCBI
Rnor_6.0	1	88,766,872 - 88,772,243 (+)	NCBI
Rnor_5.0	1	92,094,314 - 92,099,684 (-)	NCBI
RGSC_v3.4	1	85,255,190 - 85,260,560 (+)	RGD
Celera	1	79,937,451 - 79,942,812 (+)	RGD

Sequence:

show sequence

CTGGGGGGGCGTGCGACCATGAGCATGTTGAGTCTGGAAATTGGAGAAGACGTTGTGGACGGACGGCACACAAGGAGTTGATATCCATGGAGGAGCAGGACGCCAGGATCCCAGCACTGGAACCATTC
AGGGTGGAACAGGCGCCACCTCTAATCTACTATGTCCCTGACTTCATCTCCAAGGAAGAGGAGGAGTATTTGCTTCGACAGGTTTTCAATGCCCCAAAGCCAAAGTGGACCCAGCTGTCCGGGAGGAA
GCTTCAGAACTGGGGTGGGCTCCCCCACCCCCGGGGGATGGTCCCTGAGCGACTCCCTCCATGGCTTCAACGCTACGTGGACAAAGTGTCTGACCTCAGCCTTTTTGGGGGTCTCCCAGCTAACCATG
TCCTTGTGAACCAGTACCTGCCTGGGGAGGGCATCATGCCTCATGAAGATGGACCATTGTACTACCCAACAGTCAGCACCATTAGCCTGGGCTCCCATACTGTCCTTGACTTCTATGAACCTCGGCAG
CCAGACGATGACGTCCCTCCAGAACAGCCCAGGCCTCCTCAGCAGCCCATCACCTCGCTGCTGGTGGAACCACGGAGCCTGCTGGTGCTCCGGGGCACGGCTTACACACGTCTGCTCCACGGCATCAC
AGCCACCCGCGTAGATGAGCTGGACTCCACCTCGCTGCCGCCCAATGCCGCTGCCTGCCAGTCGGCGTTGCCCGGAGCCCGCCTGGTGCGTGGCACCCGTGTCTCGCTGACCATTCGACGTGTACCCC
GCGTGCTGCGCGCCAGCCTCCTGCTGAGCAAGTGACCACCAGGCTCCAAAACTCCTGACCTTGGAACCTTAGGGCAGAGGTAGCTGCCCAGGGTTATTTATTTTCCCAGTAACTGTGGAAACCACGGA
GAAGTCACCATTCCAAATAAACAGAAAATACCTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039104487 ⟹ XP_038960415

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	94,690,979 - 94,696,429 (+)	NCBI
mRatBN7.2	1	85,563,511 - 85,568,977 (+)	NCBI

RefSeq Acc Id:

XM_063283620 ⟹ XP_063139690

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	94,692,417 - 94,696,429 (+)	NCBI

RefSeq Acc Id:

XR_005501802

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	94,690,984 - 94,696,175 (+)	NCBI
mRatBN7.2	1	85,563,512 - 85,568,977 (+)	NCBI


Protein RefSeqs	NP_001120922	(Get FASTA)	NCBI Sequence Viewer
	XP_038960415	(Get FASTA)	NCBI Sequence Viewer
	XP_063139690	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH82048	(Get FASTA)	NCBI Sequence Viewer
	AAH98707	(Get FASTA)	NCBI Sequence Viewer
	EDM07772	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000043754
	ENSRNOP00000043754.3
	ENSRNOP00000072260.2

RefSeq Acc Id:

NP_001120922 ⟸ NM_001127450

- UniProtKB:

G3V9E2 (UniProtKB/TrEMBL), A6J9W2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEEQDARIPALEPFRVEQAPPLIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLSGRKLQNWGGLPHPRGMVPERLPPWLQRYVDKVSDLSLFGGLPANHVLVNQYLPGEGIMPHEDGPLYYPTVSTIS
LGSHTVLDFYEPRQPDDDVPPEQPRPPQQPITSLLVEPRSLLVLRGTAYTRLLHGITATRVDELDSTSLPPNAAACQSALPGARLVRGTRVSLTIRRVPRVLRASLLLSK

hide sequence

Ensembl Acc Id:

ENSRNOP00000072260 ⟸ ENSRNOT00000080613

Ensembl Acc Id:

ENSRNOP00000064657 ⟸ ENSRNOT00000071180

RefSeq Acc Id:	XP_038960415 ⟸ XM_039104487
- Peptide Label:	isoform X2

Ensembl Acc Id:

ENSRNOP00000043754 ⟸ ENSRNOT00000051259

Protein Domains

Fe2OG dioxygenase

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V9E2-F1-model_v2	AlphaFold	G3V9E2	1-238	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13689910

Promoter ID:

EPDNEW_R435

Type:

initiation region

Name:

Alkbh6_1

Description:

alkB homolog 6

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	88,766,896 - 88,766,956	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-60125	BioCyc
Ensembl Genes	ENSRNOG00000025216	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOG00000047943	Ensembl
Ensembl Transcript	ENSRNOT00000051259	ENTREZGENE
	ENSRNOT00000051259.4	UniProtKB/TrEMBL
	ENSRNOT00000080613.2	UniProtKB/TrEMBL
Gene3D-CATH	2.60.120.590	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7131752	IMAGE-MGC_LOAD
InterPro	AlkB-like	UniProtKB/TrEMBL
	AlkB-like_sf	UniProtKB/TrEMBL
	ALKBH6	UniProtKB/TrEMBL
	Oxoglu/Fe-dep_dioxygenase	UniProtKB/TrEMBL
KEGG Report	rno:292780	UniProtKB/TrEMBL
MGC_CLONE	MGC:95194	IMAGE-MGC_LOAD
NCBI Gene	292780	ENTREZGENE
PANTHER	ALPHA-KETOGLUTARATE-DEPENDENT DIOXYGENASE ALKB HOMOLOG 6	UniProtKB/TrEMBL
	PTHR46030	UniProtKB/TrEMBL
Pfam	2OG-FeII_Oxy_2	UniProtKB/TrEMBL
PhenoGen	Alkbh6	PhenoGen
PROSITE	FE2OG_OXY	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000025216	RatGTEx
	ENSRNOG00000047943	RatGTEx
Superfamily-SCOP	Clavaminate synthase-like	UniProtKB/TrEMBL
UniProt	A0A0G2K2I9_RAT	UniProtKB/TrEMBL
	A6J9W2	ENTREZGENE, UniProtKB/TrEMBL
	G3V9E2	ENTREZGENE, UniProtKB/TrEMBL
	Q4KM81_RAT	UniProtKB/TrEMBL
	Q66H36_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Alkbh6	alkB homolog 6	LOC108348106	alpha-ketoglutarate-dependent dioxygenase alkB homolog 6	Data merged from RGD:11413490	737654	PROVISIONAL
2016-08-02	LOC108348106	alpha-ketoglutarate-dependent dioxygenase alkB homolog 6			Symbol and Name status set to provisional	70820	PROVISIONAL
2015-07-02	Alkbh6	alkB homolog 6	Alkbh6	alkB, alkylation repair homolog 6 (E. coli)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-04	Alkbh6	alkB, alkylation repair homolog 6 (E. coli)	LOC292780	similar to hypothetical protein MGC15677	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	LOC292780	similar to hypothetical protein MGC15677			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar