Symbol:
Zbtb33
Name:
zinc finger and BTB domain containing 33
RGD ID:
1566309
Description:
Predicted to enable DNA-binding transcription repressor activity, RNA polymerase II-specific; RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; and methyl-CpG binding activity. Predicted to be involved in negative regulation of transcription by RNA polymerase II; regulation of cytokine production; and regulation of immune system process. Predicted to be located in cytosol; nucleolus; and plasma membrane. Predicted to be active in nucleoplasm. Orthologous to human ZBTB33 (zinc finger and BTB domain containing 33); PARTICIPATES IN DNA modification pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bis(2-ethylhexyl) phthalate; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC100910807; LOC501506; RGD1566309; similar to kaiso protein; transcriptional regulator Kaiso; transcriptional regulator Kaiso-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 121,828,960 - 121,836,193 (+) NCBI GRCr8 mRatBN7.2 X 116,963,337 - 116,970,547 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 116,963,347 - 116,971,023 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 119,061,678 - 119,066,347 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 122,630,827 - 122,635,496 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 120,176,705 - 120,181,374 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 124,319,299 - 124,326,506 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 124,393,332 - 124,398,001 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 124,321,551 - 124,323,960 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 124,405,073 - 124,412,271 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 7,166,136 - 7,170,805 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera X 116,181,032 - 116,185,701 (+) NCBI Celera Cytogenetic Map X q35 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Zbtb33 Rat (1->4)-beta-D-glucan multiple interactions ISO Zbtb33 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ZBTB33 mRNA CTD PMID:36331819 Zbtb33 Rat 1,2-dimethylhydrazine decreases expression ISO Zbtb33 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of ZBTB33 mRNA CTD PMID:22206623 Zbtb33 Rat 1,2-dimethylhydrazine multiple interactions ISO Zbtb33 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of ZBTB33 mRNA] CTD PMID:22206623 Zbtb33 Rat 17beta-estradiol increases expression ISO Zbtb33 (Mus musculus) 6480464 Estradiol results in increased expression of ZBTB33 mRNA CTD PMID:39298647 Zbtb33 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO ZBTB33 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ZBTB33 mRNA CTD PMID:21296121 Zbtb33 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ZBTB33 mRNA CTD PMID:33387578 Zbtb33 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Zbtb33 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ZBTB33 mRNA CTD PMID:21570461 Zbtb33 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO ZBTB33 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of ZBTB33 mRNA CTD PMID:22298810 Zbtb33 Rat 2-methylcholine affects expression ISO ZBTB33 (Homo sapiens) 6480464 beta-methylcholine affects the expression of ZBTB33 mRNA CTD PMID:21179406 Zbtb33 Rat aflatoxin B1 decreases methylation ISO ZBTB33 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of ZBTB33 gene CTD PMID:27153756 Zbtb33 Rat aristolochic acid A decreases expression ISO ZBTB33 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of ZBTB33 mRNA CTD PMID:33212167 Zbtb33 Rat arsenous acid decreases methylation ISO ZBTB33 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased methylation of ZBTB33 promoter CTD PMID:26046465 Zbtb33 Rat benzo[a]pyrene increases expression ISO Zbtb33 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ZBTB33 mRNA CTD PMID:22228805 Zbtb33 Rat benzo[a]pyrene increases methylation ISO ZBTB33 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ZBTB33 5' UTR CTD PMID:27901495 Zbtb33 Rat benzo[a]pyrene affects methylation ISO ZBTB33 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ZBTB33 promoter CTD PMID:27901495 Zbtb33 Rat benzo[a]pyrene decreases methylation ISO ZBTB33 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of ZBTB33 3' UTR CTD PMID:27901495 Zbtb33 Rat benzo[a]pyrene diol epoxide I decreases expression ISO ZBTB33 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Zbtb33 Rat beta-lapachone increases expression ISO ZBTB33 (Homo sapiens) 6480464 beta-lapachone results in increased expression of ZBTB33 mRNA CTD PMID:38218311 Zbtb33 Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [Genistein co-treated with Diethylhexyl Phthalate] results in decreased expression of ZBTB33 mRNA CTD PMID:36674726 Zbtb33 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Zbtb33 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of ZBTB33 mRNA CTD PMID:34319233 Zbtb33 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ZBTB33 mRNA CTD PMID:25181051 and PMID:38750585 Zbtb33 Rat bisphenol A increases expression ISO Zbtb33 (Mus musculus) 6480464 bisphenol A results in increased expression of ZBTB33 mRNA CTD PMID:35598803 Zbtb33 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ZBTB33 mRNA CTD PMID:30816183 Zbtb33 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ZBTB33 gene CTD PMID:28505145 Zbtb33 Rat bisphenol F increases expression ISO Zbtb33 (Mus musculus) 6480464 bisphenol F results in increased expression of ZBTB33 mRNA CTD PMID:38685157 Zbtb33 Rat cadmium dichloride decreases expression ISO Zbtb33 (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of ZBTB33 mRNA CTD PMID:24982889 Zbtb33 Rat CGP 52608 multiple interactions ISO ZBTB33 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ZBTB33 gene] CTD PMID:28238834 Zbtb33 Rat ciguatoxin CTX1B affects expression ISO Zbtb33 (Mus musculus) 6480464 Ciguatoxins affects the expression of ZBTB33 mRNA CTD PMID:18353800 Zbtb33 Rat coumarin decreases phosphorylation ISO ZBTB33 (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of ZBTB33 protein CTD PMID:35688186 Zbtb33 Rat cyclophosphamide increases expression EXP 6480464 Cyclophosphamide results in increased expression of ZBTB33 mRNA CTD PMID:27281708 Zbtb33 Rat cyclosporin A decreases expression ISO ZBTB33 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ZBTB33 mRNA CTD PMID:27989131 Zbtb33 Rat deoxynivalenol increases expression ISO ZBTB33 (Homo sapiens) 6480464 deoxynivalenol results in increased expression of ZBTB33 mRNA CTD PMID:31863870 Zbtb33 Rat diarsenic trioxide decreases methylation ISO ZBTB33 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased methylation of ZBTB33 promoter CTD PMID:26046465 Zbtb33 Rat doxorubicin decreases expression ISO ZBTB33 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ZBTB33 mRNA CTD PMID:29803840 Zbtb33 Rat ethanol multiple interactions ISO ZBTB33 (Homo sapiens) 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of ZBTB33 mRNA CTD PMID:29432896 Zbtb33 Rat folic acid decreases expression ISO Zbtb33 (Mus musculus) 6480464 Folic Acid results in decreased expression of ZBTB33 mRNA CTD PMID:25629700 Zbtb33 Rat folic acid multiple interactions ISO Zbtb33 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of ZBTB33 mRNA] CTD PMID:22206623 Zbtb33 Rat genistein multiple interactions EXP 6480464 [Genistein co-treated with Diethylhexyl Phthalate] results in decreased expression of ZBTB33 mRNA CTD PMID:36674726 Zbtb33 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of ZBTB33 mRNA CTD PMID:33387578 Zbtb33 Rat paracetamol decreases expression ISO ZBTB33 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ZBTB33 mRNA CTD PMID:21420995 Zbtb33 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Zbtb33 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ZBTB33 mRNA CTD PMID:36331819 Zbtb33 Rat pirinixic acid multiple interactions ISO ZBTB33 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of ZBTB33 mRNA CTD PMID:19710929 Zbtb33 Rat silver atom decreases expression ISO ZBTB33 (Homo sapiens) 6480464 Silver results in decreased expression of ZBTB33 mRNA CTD PMID:26014281 Zbtb33 Rat silver(0) decreases expression ISO ZBTB33 (Homo sapiens) 6480464 Silver results in decreased expression of ZBTB33 mRNA CTD PMID:26014281 Zbtb33 Rat titanium dioxide increases methylation ISO Zbtb33 (Mus musculus) 6480464 titanium dioxide results in increased methylation of ZBTB33 gene CTD PMID:35295148 Zbtb33 Rat titanium dioxide decreases methylation ISO Zbtb33 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ZBTB33 promoter CTD PMID:35295148 Zbtb33 Rat trichostatin A affects expression ISO ZBTB33 (Homo sapiens) 6480464 trichostatin A affects the expression of ZBTB33 mRNA CTD PMID:28542535 Zbtb33 Rat triphenyl phosphate affects expression ISO ZBTB33 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ZBTB33 mRNA CTD PMID:37042841 Zbtb33 Rat urethane decreases expression ISO ZBTB33 (Homo sapiens) 6480464 Urethane results in decreased expression of ZBTB33 mRNA CTD PMID:28818685 Zbtb33 Rat valproic acid affects expression ISO ZBTB33 (Homo sapiens) 6480464 Valproic Acid affects the expression of ZBTB33 mRNA CTD PMID:25979313 Zbtb33 Rat valproic acid decreases expression ISO ZBTB33 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ZBTB33 mRNA CTD PMID:23179753 and PMID:27188386
Zbtb33 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 121,828,960 - 121,836,193 (+) NCBI GRCr8 mRatBN7.2 X 116,963,337 - 116,970,547 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 116,963,347 - 116,971,023 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 119,061,678 - 119,066,347 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 122,630,827 - 122,635,496 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 120,176,705 - 120,181,374 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 124,319,299 - 124,326,506 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 124,393,332 - 124,398,001 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 124,321,551 - 124,323,960 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 124,405,073 - 124,412,271 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 7,166,136 - 7,170,805 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera X 116,181,032 - 116,185,701 (+) NCBI Celera Cytogenetic Map X q35 NCBI
ZBTB33 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 120,250,812 - 120,258,398 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 120,250,752 - 120,258,398 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 119,384,667 - 119,392,253 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 119,268,635 - 119,276,279 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 119,166,488 - 119,174,133 NCBI Celera X 119,850,192 - 119,857,836 (+) NCBI Celera Cytogenetic Map X q24 NCBI HuRef X 108,837,055 - 108,844,699 (+) NCBI HuRef CHM1_1 X 119,295,897 - 119,303,542 (+) NCBI CHM1_1 T2T-CHM13v2.0 X 118,625,869 - 118,633,458 (+) NCBI T2T-CHM13v2.0
Zbtb33 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 37,278,670 - 37,285,923 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 37,278,670 - 37,285,923 (+) Ensembl GRCm39 Ensembl GRCm38 X 38,189,793 - 38,197,046 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 38,189,793 - 38,197,046 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 35,542,970 - 35,550,223 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 34,423,425 - 34,439,167 (+) NCBI MGSCv36 mm8 Celera X 25,835,372 - 25,842,625 (+) NCBI Celera Cytogenetic Map X A3.3 NCBI cM Map X 22.45 NCBI
Zbtb33 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955572 1,628,263 - 1,635,828 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955572 1,628,263 - 1,636,299 (-) NCBI ChiLan1.0 ChiLan1.0
ZBTB33 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 119,796,471 - 119,805,624 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 119,800,074 - 119,809,229 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 109,521,333 - 109,530,467 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 119,710,140 - 119,717,795 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 119,712,818 - 119,714,836 (+) Ensembl panpan1.1 panPan2
ZBTB33 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 92,243,159 - 92,250,940 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 92,245,000 - 92,247,984 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 78,272,158 - 78,280,057 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 93,981,166 - 93,989,061 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 93,976,404 - 93,989,041 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 91,436,152 - 91,444,048 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 93,193,021 - 93,200,919 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 92,974,050 - 92,981,947 (+) NCBI UU_Cfam_GSD_1.0
Zbtb33 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 X 91,196,712 - 91,205,572 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936479 9,781,952 - 9,790,821 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936479 9,781,923 - 9,791,000 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ZBTB33 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 98,405,319 - 98,414,279 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 98,370,137 - 98,413,686 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 113,104,986 - 113,132,862 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ZBTB33 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Vero_WHO_p1.0 NW_023666065 32,973,319 - 32,981,015 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Zbtb33
.
Predicted Target Of
Count of predictions: 258 Count of miRNA genes: 163 Interacting mature miRNAs: 181 Transcripts: ENSRNOT00000049424, ENSRNOT00000074486 Prediction methods: Microtar, Miranda, Pita, Rnahybrid Result types: miRGate_prediction
1598872 Memor14 Memory QTL 14 4.5 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 93956491 138956491 Rat 1598856 Memor1 Memory QTL 1 1.9 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) X 103312877 148312877 Rat 1598809 Memor15 Memory QTL 15 4.4 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 103312877 148312877 Rat 738025 Stresp3 Stress response QTL 3 4.61 0.0066 stress-related behavior trait (VT:0010451) defensive burying - approach X 100567703 150256146 Rat 61430 Cia18 Collagen induced arthritis QTL 18 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 14843113 120568734 Rat 738029 Stresp2 Stress response QTL 2 3.4 0.0004 stress-related behavior trait (VT:0010451) defensive burying - approach X 112934952 138400867 Rat 61431 Cia19 Collagen induced arthritis QTL 19 4.4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 65612192 120568734 Rat 5685004 Bss104 Bone structure and strength QTL 104 3.9 tibia area (VT:1000281) tibia area measurement (CMO:0001382) X 113805422 126975220 Rat 10059603 Bw174 Body weight QTL 174 3.4 0.025 body mass (VT:0001259) body weight (CMO:0000012) X 113937816 152453651 Rat 724551 Glom1 Glomerulus QTL 1 2.8 0.0004 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) X 75294106 120294106 Rat 1598837 Memor13 Memory QTL 13 3.2 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 41052407 146860749 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
3
11
42
94
72
74
45
35
45
188
92
82
40
53
29
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000049424 ⟹ ENSRNOP00000050403
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 116,963,347 - 116,971,023 (+) Ensembl Rnor_6.0 Ensembl X 124,393,332 - 124,398,001 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000074486 ⟹ ENSRNOP00000066134
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl X 124,321,551 - 124,323,960 (+) Ensembl
RefSeq Acc Id:
NM_001109314 ⟹ NP_001102784
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 121,829,085 - 121,833,754 (+) NCBI mRatBN7.2 X 116,963,439 - 116,968,108 (+) NCBI Rnor_6.0 X 124,319,398 - 124,324,067 (+) NCBI Rnor_5.0 X 124,405,073 - 124,412,271 (+) NCBI RGSC_v3.4 X 7,166,136 - 7,170,805 (-) RGD Celera X 116,181,032 - 116,185,701 (+) RGD
Sequence:
GGCAGCTTCGGGGAGGACTCTGACCCTTCCTTGGCCGGAGGAGGAGTGAGCGGCCGCCCGCGGAGCAGGTGAGGAGTGGGCTGGGCACCGGACCCAGGAGACGGAGCCCGCCTGCGCCTTCAATGCCC
hide sequence
RefSeq Acc Id:
XM_006257485 ⟹ XP_006257547
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 121,828,960 - 121,836,193 (+) NCBI mRatBN7.2 X 116,963,337 - 116,970,547 (+) NCBI
Sequence:
GCAGAGCCCGGCGTCCGGAGCGGCGTCAGTGGAAGCCGCTTTGACGTCGGCGGAAACTGGAGCG
hide sequence
RefSeq Acc Id:
NP_001102784 ⟸ NM_001109314
- UniProtKB:
D3ZAN8 (UniProtKB/TrEMBL), A6JMJ5 (UniProtKB/TrEMBL)
- Sequence:
MESRKLISATDIQYSASLLNSLNEQRGHGLFCDVTVIVEDRKFRAHRNILSASSTYFHQLFSVAGQVVELSFIRAEIFAEILNYIYSSKIVRVRADLLDELIKSGQLLGVKFIAELGVPLSQVKSISG
hide sequence
Ensembl Acc Id:
ENSRNOP00000066134 ⟸ ENSRNOT00000074486
RefSeq Acc Id:
XP_006257547 ⟸ XM_006257485
- Peptide Label:
isoform X1
- UniProtKB:
D3ZAN8 (UniProtKB/TrEMBL), A6JMJ5 (UniProtKB/TrEMBL)
- Sequence:
MESRKLISATDIQYSASLLNSLNEQRGHGLFCDVTVIVEDRKFRAHRNILSASSTYFHQLFSVA
hide sequence
Ensembl Acc Id:
ENSRNOP00000050403 ⟸ ENSRNOT00000049424
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Zbtb33
zinc finger and BTB domain containing 33
LOC100910807
transcriptional regulator Kaiso-like
Data merged from RGD:6496755
737654 PROVISIONAL
2012-07-05
LOC100910807
transcriptional regulator Kaiso-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2008-03-07
Zbtb33
zinc finger and BTB domain containing 33
RGD1566309_predicted
similar to kaiso protein (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-07
RGD1566309_predicted
similar to kaiso protein (predicted)
LOC501506
similar to kaiso protein
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC501506
similar to kaiso protein
Symbol and Name status set to provisional
70820 PROVISIONAL
