Advanced Search (OLGA)

Gene: B9d2 (B9 domain containing 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

B9d2

Name:

B9 domain containing 2

RGD ID:

1566122

Description:

Predicted to enable gamma-tubulin binding activity. Predicted to be involved in cilium assembly. Predicted to be located in ciliary transition zone; membrane; and microtubule organizing center. Predicted to be part of MKS complex. Human ortholog(s) of this gene implicated in Joubert syndrome. Orthologous to human B9D2 (B9 domain containing 2); INTERACTS WITH 6-propyl-2-thiouracil; amphetamine; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

B9 domain-containing protein 2; B9 protein domain 2; LOC308443; RGD1566122; similar to CDNA sequence BC028440

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	B9D2 (B9 domain containing 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	B9d2 (B9 protein domain 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	B9d2 (B9 domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	B9D2 (B9 domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	B9d2 (B9 domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	B9D2 (B9 domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	B9D2 (B9 domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	B9d2 (B9 domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GJC2 (gap junction protein gamma 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	B9D2 (B9 domain containing 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	B9d2 (B9 protein domain 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	b9d2 (B9 domain containing 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	B9d2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mksr-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	b9d2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	90,315,472 - 90,323,143 (+)	NCBI		GRCr8
mRatBN7.2	1	81,189,395 - 81,195,383 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	81,189,405 - 81,195,356 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	86,581,955 - 86,587,548 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	95,133,441 - 95,139,028 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	88,337,751 - 88,343,344 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	82,473,254 - 82,479,704 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	82,473,737 - 82,479,900 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	83,735,237 - 83,741,209 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	80,888,733 - 80,894,049 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	75,629,345 - 75,634,847 (+)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
B9d2	Rat	Carpenter syndrome 2		ISO	B9D2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Carpenter syndrome 2	ClinVar	PMID:28492532
B9d2	Rat	congenital hypoplastic anemia		ISO	B9D2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital hypoplastic anemia	ClinVar	PMID:28492532
B9d2	Rat	craniosynostosis 1		ISO	B9D2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: TWIST1-related craniosynostosis	ClinVar	PMID:28492532
B9d2	Rat	Diamond-Blackfan anemia		ISO	B9D2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Aase syndrome	ClinVar	PMID:28492532
B9d2	Rat	Joubert syndrome		ISO	B9D2 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:21763481 more ...
B9d2	Rat	Joubert syndrome 1		ISO	B9D2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial aplasia of the vermis	ClinVar	PMID:21763481 more ...
B9d2	Rat	maple syrup urine disease		ISO	B9D2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Maple syrup urine disease	ClinVar	PMID:28492532
B9d2	Rat	Meckel syndrome		ISO	B9D2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Meckel-Gruber syndrome	ClinVar	PMID:28492532
B9d2	Rat	Meckel syndrome 1		ISO	B9D2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Dysencephalia splachnocystica	ClinVar	PMID:28492532
B9d2	Rat	Meckel Syndrome 10		ISO	B9D2 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:21763481 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
B9d2	Rat	Meckel Syndrome 10		ISO	B9D2 (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
B9d2	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	B9d2 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of B9D2 mRNA	CTD	PMID:22206623
B9d2	Rat	1,2-dimethylhydrazine	increases expression	ISO	B9d2 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of B9D2 mRNA	CTD	PMID:22206623
B9d2	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	B9d2 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of B9D2 mRNA	CTD	PMID:21570461
B9d2	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	B9d2 (Mus musculus)	6480464	Fenretinide results in increased expression of B9D2 mRNA	CTD	PMID:28973697
B9d2	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of B9D2 mRNA	CTD	PMID:24780913
B9d2	Rat	amphetamine	increases expression	EXP		6480464	Amphetamine results in increased expression of B9D2 mRNA	CTD	PMID:30779732
B9d2	Rat	antirheumatic drug	decreases expression	ISO	B9D2 (Homo sapiens)	6480464	Antirheumatic Agents results in decreased expression of B9D2 mRNA	CTD	PMID:24449571
B9d2	Rat	arsane	affects methylation	ISO	B9D2 (Homo sapiens)	6480464	Arsenic affects the methylation of B9D2 gene	CTD	PMID:25304211
B9d2	Rat	arsenic atom	affects methylation	ISO	B9D2 (Homo sapiens)	6480464	Arsenic affects the methylation of B9D2 gene	CTD	PMID:25304211
B9d2	Rat	benzo[a]pyrene	increases methylation	ISO	B9D2 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of B9D2 5' UTR	CTD	PMID:27901495
B9d2	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of B9D2 mRNA	CTD	PMID:25181051
B9d2	Rat	cadmium dichloride	decreases expression	EXP		6480464	Cadmium Chloride results in decreased expression of B9D2 mRNA	CTD	PMID:33453195
B9d2	Rat	chlormequat chloride	increases expression	EXP		6480464	Chlormequat results in increased expression of B9D2 protein	CTD	PMID:34958886
B9d2	Rat	clofibrate	decreases expression	ISO	B9d2 (Mus musculus)	6480464	Clofibrate results in decreased expression of B9D2 mRNA	CTD	PMID:23811191
B9d2	Rat	cyclosporin A	increases expression	ISO	B9d2 (Mus musculus)	6480464	Cyclosporine results in increased expression of B9D2 mRNA	CTD	PMID:19770486
B9d2	Rat	ethanol	increases expression	ISO	B9d2 (Mus musculus)	6480464	Ethanol results in increased expression of B9D2 mRNA	CTD	PMID:30319688
B9d2	Rat	folic acid	multiple interactions	ISO	B9d2 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of B9D2 mRNA	CTD	PMID:22206623
B9d2	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of B9D2 mRNA	CTD	PMID:33387578
B9d2	Rat	methidathion	decreases expression	ISO	B9d2 (Mus musculus)	6480464	methidathion results in decreased expression of B9D2 mRNA	CTD	PMID:34813904
B9d2	Rat	nitrates	multiple interactions	ISO	B9d2 (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of B9D2 mRNA	CTD	PMID:35964746
B9d2	Rat	paracetamol	affects expression	ISO	B9d2 (Mus musculus)	6480464	Acetaminophen affects the expression of B9D2 mRNA	CTD	PMID:17562736
B9d2	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of B9D2 mRNA	CTD	PMID:33387578
B9d2	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	B9d2 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of B9D2 mRNA	CTD	PMID:36331819
B9d2	Rat	rotenone	decreases expression	ISO	B9D2 (Homo sapiens)	6480464	Rotenone results in decreased expression of B9D2 mRNA	CTD	PMID:29955902
B9d2	Rat	sodium arsenite	decreases expression	ISO	B9D2 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of B9D2 mRNA	CTD	PMID:38568856
B9d2	Rat	temozolomide	increases expression	ISO	B9D2 (Homo sapiens)	6480464	Temozolomide results in increased expression of B9D2 mRNA	CTD	PMID:31758290
B9d2	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of B9D2 mRNA	CTD	PMID:34492290
B9d2	Rat	titanium dioxide	decreases methylation	ISO	B9d2 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of B9D2 promoter alternative form	CTD	PMID:35295148
B9d2	Rat	tremolite asbestos	decreases expression	ISO	B9d2 (Mus musculus)	6480464	tremolite results in decreased expression of B9D2 mRNA	CTD	PMID:29279043
B9d2	Rat	triphenyl phosphate	affects expression	ISO	B9D2 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of B9D2 mRNA	CTD	PMID:37042841
B9d2	Rat	triptonide	affects expression	ISO	B9d2 (Mus musculus)	6480464	triptonide affects the expression of B9D2 mRNA	CTD	PMID:33045310

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
B9d2	Rat	cell projection organization	involved_in	IEA	UniProtKB-KW:KW-0970	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
B9d2	Rat	cilium assembly	involved_in	ISS	UniProtKB:Q9NXB0	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
B9d2	Rat	cilium assembly	involved_in	IEA	UniProtKB:Q3UK10 and ensembl:ENSMUSP00000104040	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
B9d2	Rat	cilium assembly	involved_in	IBA	FB:FBgn0030395 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
B9d2	Rat	cilium assembly	involved_in	ISO	B9d2 (Mus musculus)	1624291	PMID:18287022	RGD	PMID:18287022
B9d2	Rat	cilium assembly	involved_in	ISS	UniProtKB:Q3UK10	1600115	GO_REF:0000024	UniProt	GO_REF:0000024

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
B9d2	Rat	cell projection	located_in	IEA	UniProtKB-KW:KW-0966	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
B9d2	Rat	centrosome	located_in	ISO	B9D2 (Homo sapiens)	1624291	PMID:19208769	RGD	PMID:19208769
B9d2	Rat	centrosome	located_in	IEA	UniProtKB:Q9BPU9 and ensembl:ENSP00000243578	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
B9d2	Rat	centrosome	located_in	ISS	UniProtKB:Q9NXB0	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
B9d2	Rat	ciliary basal body	located_in	ISS	UniProtKB:Q9NXB0	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
B9d2	Rat	ciliary basal body	located_in	IEA	UniProtKB:Q9BPU9 and ensembl:ENSP00000243578	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
B9d2	Rat	ciliary basal body	located_in	ISO	B9D2 (Homo sapiens)	1624291	PMID:19208769	RGD	PMID:19208769
B9d2	Rat	ciliary transition zone	located_in	ISO	B9D2 (Homo sapiens)	1624291	PMID:15916950 more ...	RGD	PMID:15916950 more ...
B9d2	Rat	cilium	located_in	IEA	ARBA:ARBA00028353	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
B9d2	Rat	cilium	located_in	IEA	UniProtKB-KW:KW-0969	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
B9d2	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
B9d2	Rat	cytoskeleton	located_in	IEA	UniProtKB-KW:KW-0206	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
B9d2	Rat	membrane	located_in	ISO	B9d2 (Mus musculus)	1624291	PMID:22179047	RGD	PMID:22179047
B9d2	Rat	membrane	located_in	IEA	UniProtKB:Q3UK10 and ensembl:ENSMUSP00000104040	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
B9d2	Rat	MKS complex	part_of	ISS	UniProtKB:Q3UK10	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
B9d2	Rat	MKS complex	part_of	IEA	UniProtKB:Q3UK10 and ensembl:ENSMUSP00000104040	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
B9d2	Rat	MKS complex	part_of	IBA	MGI:1351471 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
B9d2	Rat	MKS complex	part_of	ISO	B9d2 (Mus musculus)	1624291	PMID:22179047	RGD	PMID:22179047
B9d2	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
B9d2	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
B9d2	Rat	gamma-tubulin binding	enables	ISS	UniProtKB:Q3UK10	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
B9d2	Rat	gamma-tubulin binding	enables	IEA	UniProtKB:Q3UK10 and ensembl:ENSMUSP00000104040	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
B9d2	Rat	gamma-tubulin binding	enables	ISO	B9d2 (Mus musculus)	1624291	PMID:18287022	RGD	PMID:18287022
B9d2	Rat	protein binding	enables	ISO	B9D2 (Homo sapiens)	1624291	UniProtKB:O43711 more ...	RGD	PMID:21602787 more ...
B9d2	Rat	protein binding	enables	ISO	B9d2 (Mus musculus)	1624291	PR:Q2MV57 more ...	RGD	PMID:21763481 and PMID:22179047

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:15916950	PMID:18287022	PMID:19208769	PMID:21422230	PMID:21763481	PMID:22179047	PMID:39455645

B9d2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	90,315,472 - 90,323,143 (+)	NCBI		GRCr8
mRatBN7.2	1	81,189,395 - 81,195,383 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	81,189,405 - 81,195,356 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	86,581,955 - 86,587,548 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	95,133,441 - 95,139,028 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	88,337,751 - 88,343,344 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	82,473,254 - 82,479,704 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	82,473,737 - 82,479,900 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	83,735,237 - 83,741,209 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	80,888,733 - 80,894,049 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	75,629,345 - 75,634,847 (+)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

B9D2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	41,354,417 - 41,364,149 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	41,354,417 - 41,364,165 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	41,860,322 - 41,870,054 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	46,552,166 - 46,561,877 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	19	38,660,483 - 38,669,951 (-)	NCBI		Celera
Cytogenetic Map	19	q13.2	NCBI
HuRef	19	38,292,411 - 38,301,879 (-)	NCBI		HuRef
CHM1_1	19	41,859,986 - 41,869,742 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	44,175,285 - 44,184,729 (-)	NCBI		T2T-CHM13v2.0

B9d2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	25,380,205 - 25,385,987 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	25,380,205 - 25,385,983 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	25,680,780 - 25,686,562 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	25,680,780 - 25,686,558 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	26,466,177 - 26,471,577 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	25,389,918 - 25,395,318 (+)	NCBI		MGSCv36	mm8
Celera	7	20,290,071 - 20,295,470 (+)	NCBI		Celera
Cytogenetic Map	7	A3	NCBI
cM Map	7	13.97	NCBI

B9d2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955555	288,919 - 295,860 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955555	288,919 - 295,861 (-)	NCBI	ChiLan1.0	ChiLan1.0

B9D2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	47,564,531 - 47,576,762 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	49,433,306 - 49,442,722 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	38,347,505 - 38,357,319 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	46,853,954 - 46,864,036 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	46,853,954 - 46,864,014 (-)	Ensembl	panpan1.1		panPan2

B9d2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	15,330,962 - 15,337,206 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936661	3,758,909 - 3,765,513 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936661	3,759,031 - 3,765,361 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

B9D2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	49,349,708 - 49,366,012 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	49,349,704 - 49,358,420 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	45,142,563 - 45,151,259 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

B9D2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	35,674,786 - 35,684,646 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	35,674,539 - 35,683,215 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	13,909,119 - 13,920,077 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

B9d2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624907	176,827 - 184,574 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624907	177,031 - 183,776 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in B9d2
34 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	185
Count of miRNA genes:	134
Interacting mature miRNAs:	142
Transcripts:	ENSRNOT00000028029
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	53895117	82174945	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	72197680	90508767	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889494	Scort2	Serum corticosterone level QTL 2	4.2		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	80592172	125592172	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	53895117	82174945	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	78430754	91209302	Rat

RH139885

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	81,194,907 - 81,195,093 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	82,479,244 - 82,479,429	NCBI	Rnor6.0
Rnor_5.0	1	83,740,753 - 83,740,938	UniSTS	Rnor5.0
Celera	1	75,634,392 - 75,634,577	UniSTS
RH 3.4 Map	1	826.0	UniSTS
Cytogenetic Map	1	q22	UniSTS
Cytogenetic Map	1	q21	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001107494	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006228438	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC134759	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028029 ⟹ ENSRNOP00000028029

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	81,189,422 - 81,195,356 (+)	Ensembl
Rnor_6.0 Ensembl	1	82,473,737 - 82,479,900 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105804 ⟹ ENSRNOP00000077704

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	81,189,405 - 81,192,376 (+)	Ensembl

RefSeq Acc Id:

NM_001107494 ⟹ NP_001100964

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	90,317,550 - 90,323,143 (+)	NCBI
mRatBN7.2	1	81,189,767 - 81,195,363 (+)	NCBI
Rnor_6.0	1	82,474,106 - 82,479,699 (+)	NCBI
Rnor_5.0	1	83,735,237 - 83,741,209 (+)	NCBI
RGSC_v3.4	1	80,888,733 - 80,894,049 (+)	RGD
Celera	1	75,629,345 - 75,634,847 (+)	RGD

Sequence:

show sequence

CTGGTGCAGATTCCCGCACCTCTCGGGGGTGGGGGGTCTTCCCCATTTTTCTTGGGCTTTTCTGGGAAGGTGGCTTGTATCTGTGATGAAGACCACATTGTCAGTGTGTTAGTGGAATTAGCTTAGAA
TCACAGTACTGTTCTTCATGCTATATTGGCTTCAGTTTTCCCAGTTGTCCAAAGGAAATAATAAGTTTACCTCACAGAGCTGTGATTGGATTTTTCCTTTCCTAGAGCCATGGCCGAAGTGCACGTGA
TCGGGCAGATCATAGGGGCCACGGGTTTCTCTGAAGGTAGCCTCTTCTGCAAGTGGGGCATCCACACAGGGGCCGCATGGAAGCTCCTGTCAGGCGTCCGGGAAGGCCAGACGCAGGTAGACACACCC
CAGACAGGGGACATGGCTTACTGGTCCCACCCCATTGACCTGCACTTTGCTACAAAAGGTCTCCAAGGTTGGCCTCGACTTCATCTCCAGGTGTGGTCCCAGGACAGCTTTGGCCGCTGCCAGCTTGC
TGGCTATGGCTTTTGCCATGTGCCTAGCAGCCCAGGCACTCACCAGCTGGACTGCCCTACATGGAGGCCCCTGGGTAGTTGGAGGGAGCAGCTAGCACGGGCTTTCGTGGGTGGCGGGCCACAGCTGC
TGCACGCAGACACCATCTACAGCGGGGCCGACCGCTACCGCCTGCACACGGCCGCGGGTGGCACAGTGCACCTTGGTATCGGTCTGCTGCTGCGCCACTTTGATCGCTACGGTGTGGAGTGTTGAGGG
ACTTCACTGCCACCAGTCACCATCATCCACAGCCCTGCGCACACGACGGCACAGCAGTGAAACAGGCACATAGACTCTGGAGACTGTCAGTCCTGATCTCACCCAAGTCATGGCCCTTATGCCATGGA
CTGCAAGGCCAGGAACTACCCCTGTGGCCCATGCTCCACTGAATTACCGGGTAAAAGTCTGTGAGTTGGAGGGACTTGAGGAGAGCATGCTGTTTGGCACTGTCAGGGGCACTTAATAAAAGCATGCA
TTTCTCATAGGTA

hide sequence

RefSeq Acc Id:

XM_006228438 ⟹ XP_006228500

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	90,315,472 - 90,323,139 (+)	NCBI
mRatBN7.2	1	81,189,395 - 81,195,383 (+)	NCBI
Rnor_6.0	1	82,473,254 - 82,479,704 (+)	NCBI
Rnor_5.0	1	83,735,237 - 83,741,209 (+)	NCBI

Sequence:

show sequence

CTCTGGAAGAGCAACAAGCAGCAATGTGAGGGAGCTCTGAAAACTGAAGAGAAAACCTGTAACA
GAAGAGAAAACCTACTTCCCAAGTCCTCTAGTGTCAGAATGTGGAGATCCTTTTATCCCTTCAGCTGTAACAGAGAGATGATCACAATGTGAATTCCTTTAGGTGCCCGTTTGGTGTCATCTGGCTTC
GTTCTGACTATGATCCTGAACAGGAAAGGTGTTTTGTTTTGTTTAAGGAAGCAAAGACTATCAATAGATTTTCTTATTGCGTGAAGAAGATATGGAGAGGAAACAGTTGGCGCTCTAACTTCCTCGAC
TGCTGATGGAGATAACCCGCCAGGCCTCCCACTCTGAGGCGTAAGGCGTCGCGAGGGTAAGACCGACGCAGAGTTCCCAAAAATGTACCGAATGACTGCGTCCATCACAACTACGCCCCACCCCCAGA
GGGCAAATATAGCACCAATCATCAGCGCACAGGGCGGGCTCAGGGGAGGAGCCTGCTGTTGCCCCAGCAACAACCCGGGAACCCTAGGAGAGCGAGGCTGCGGACCTATCTACCTCAGGTCTTCCTCC
GCCTGGAAGGGCCCGGGCGGGGCGCGAGACTAGCCTCGGCGGCGGCCGCAAAGAGGAAGAGGCCAGGCCCATGAACTACCATCCCCGAAGCAGCTTTCGCTTCTAACGGTCAAGTACGCAGAGAGCCA
TGGCCGAAGTGCACGTGATCGGGCAGATCATAGGGGCCACGGGTTTCTCTGAAGGTAGCCTCTTCTGCAAGTGGGGCATCCACACAGGGGCCGCATGGAAGCTCCTGTCAGGCGTCCGGGAAGGCCAG
ACGCAGGTAGACACACCCCAGACAGGGGACATGGCTTACTGGTCCCACCCCATTGACCTGCACTTTGCTACAAAAGGTCTCCAAGGTTGGCCTCGACTTCATCTCCAGGTGTGGTCCCAGGACAGCTT
TGGCCGCTGCCAGCTTGCTGGCTATGGCTTTTGCCATGTGCCTAGCAGCCCAGGCACTCACCAGCTGGACTGCCCTACATGGAGGCCCCTGGGTAGTTGGAGGGAGCAGCTAGCACGGGCTTTCGTGG
GTGGCGGGCCACAGCTGCTGCACGCAGACACCATCTACAGCGGGGCCGACCGCTACCGCCTGCACACGGCCGCGGGTGGCACAGTGCACCTTGGTATCGGTCTGCTGCTGCGCCACTTTGATCGCTAC
GGTGTGGAGTGTTGAGGGACTTCACTGCCACCAGTCACCATCATCCACAGCCCTGCGCACACGACGGCACAGCAGTGAAACAGGCACATAGACTCTGGAGACTGTCAGTCCTGATCTCACCCAAGTCA
TGGCCCTTATGCCATGGACTGCAAGGCCAGGAACTACCCCTGTGGCCCATGCTCCACTGAATTACCGGGTAAAAGTCTGTGAGTTGGAGGGACTTGAGGAGAGCATGCTGTTTGGCACTGTCAGGGGC
ACTTAATAAAAGCATGCATTTCTCATAGGTAAGGTG

hide sequence


Protein RefSeqs	NP_001100964	(Get FASTA)	NCBI Sequence Viewer
	XP_006228500	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM07999	(Get FASTA)	NCBI Sequence Viewer
	EDM08000	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028029
	ENSRNOP00000028029.5
GenBank Protein	P0C5J3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001100964 ⟸ NM_001107494
- UniProtKB:	P0C5J3 (UniProtKB/Swiss-Prot), A6J984 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAEVHVIGQIIGATGFSEGSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQTGDMAYWSHPIDLHFATKGLQGWPRLHLQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLDCPTWRPLGSWREQLARAFV GGGPQLLHADTIYSGADRYRLHTAAGGTVHLGIGLLLRHFDRYGVEC hide sequence

RefSeq Acc Id:	XP_006228500 ⟸ XM_006228438
- Peptide Label:	isoform X1
- UniProtKB:	P0C5J3 (UniProtKB/Swiss-Prot), A6J984 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAEVHVIGQIIGATGFSEGSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQTGDMAYWSHPIDLH FATKGLQGWPRLHLQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLDCPTWRPLGSWREQLARAFVGGGPQLLHADTIYSGADRYRLHTAAGGTVHLGIGLLLRHFDRYGVEC hide sequence

Ensembl Acc Id:

ENSRNOP00000028029 ⟸ ENSRNOT00000028029

Ensembl Acc Id:

ENSRNOP00000077704 ⟸ ENSRNOT00000105804

Protein Domains

C2 B9-type

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P0C5J3-F1-model_v2	AlphaFold	P0C5J3	1-175	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13689822

Promoter ID:

EPDNEW_R346

Type:

multiple initiation site

Name:

B9d2_1

Description:

B9 domain containing 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	82,473,767 - 82,473,827	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-60372	BioCyc
Ensembl Genes	ENSRNOG00000028753	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000028029	ENTREZGENE
	ENSRNOT00000028029.7	UniProtKB/Swiss-Prot
InterPro	B9_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:308443	UniProtKB/Swiss-Prot
NCBI Gene	308443	ENTREZGENE
PANTHER	B9 DOMAIN-CONTAINING PROTEIN 2	UniProtKB/Swiss-Prot
	PTHR12968	UniProtKB/Swiss-Prot
Pfam	B9-C2	UniProtKB/Swiss-Prot
PhenoGen	B9d2	PhenoGen
PROSITE	PS51381	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000028753	RatGTEx
UniProt	A0A8I5Y6N1_RAT	UniProtKB/TrEMBL
	A6J984	ENTREZGENE, UniProtKB/TrEMBL
	B9D2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-08-18	B9d2	B9 domain containing 2	B9d2	B9 protein domain 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	B9d2	B9 protein domain 2	RGD1566122_predicted	similar to CDNA sequence BC028440 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1566122_predicted	similar to CDNA sequence BC028440 (predicted)	LOC308443	similar to CDNA sequence BC028440	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC308443	similar to CDNA sequence BC028440			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM