Symbol:
Tmem51
Name:
transmembrane protein 51
RGD ID:
1565452
Description:
Predicted to be located in membrane. Orthologous to human TMEM51 (transmembrane protein 51); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC500578; RGD1565452; similar to BC003277 protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TMEM51 (transmembrane protein 51) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Tmem51 (transmembrane protein 51) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tmem51 (transmembrane protein 51) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TMEM51 (transmembrane protein 51) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TMEM51 (transmembrane protein 51) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tmem51 (transmembrane protein 51) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TMEM51 (transmembrane protein 51) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TMEM51 (transmembrane protein 51) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tmem51 (transmembrane protein 51) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
TMEM51 (transmembrane protein 51)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tmem51 (transmembrane protein 51)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tmem51b (transmembrane protein 51b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tmem51a (transmembrane protein 51a)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
tmem51
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 159,608,865 - 159,658,918 (-) NCBI GRCr8 mRatBN7.2 5 154,325,853 - 154,375,882 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 154,325,856 - 154,375,882 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 157,011,201 - 157,061,248 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 158,784,518 - 158,834,563 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 158,773,627 - 158,823,672 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 160,570,510 - 160,620,647 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 160,570,502 - 160,620,334 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 164,280,429 - 164,331,199 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 160,938,672 - 160,988,578 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 152,676,000 - 152,726,010 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tmem51 Rat (1->4)-beta-D-glucan multiple interactions ISO Tmem51 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TMEM51 mRNA CTD PMID:36331819 Tmem51 Rat 1,2-dimethylhydrazine multiple interactions ISO Tmem51 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TMEM51 mRNA CTD PMID:22206623 Tmem51 Rat 17beta-estradiol increases expression ISO Tmem51 (Mus musculus) 6480464 Estradiol results in increased expression of TMEM51 mRNA CTD PMID:39298647 Tmem51 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:27291303 Tmem51 Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO TMEM51 (Homo sapiens) 6480464 [2 more ... CTD PMID:32653021 Tmem51 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO TMEM51 (Homo sapiens) 6480464 2 more ... CTD PMID:19095052 Tmem51 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TMEM51 mRNA CTD PMID:33387578 Tmem51 Rat 4,4'-sulfonyldiphenol increases expression ISO Tmem51 (Mus musculus) 6480464 bisphenol S results in increased expression of TMEM51 mRNA CTD PMID:30951980 Tmem51 Rat 4-hydroxyphenyl retinamide increases expression ISO Tmem51 (Mus musculus) 6480464 Fenretinide results in increased expression of TMEM51 mRNA CTD PMID:28973697 Tmem51 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of TMEM51 mRNA CTD PMID:24780913 Tmem51 Rat acrylamide increases expression ISO TMEM51 (Homo sapiens) 6480464 Acrylamide results in increased expression of TMEM51 mRNA CTD PMID:32763439 Tmem51 Rat all-trans-retinoic acid increases expression ISO TMEM51 (Homo sapiens) 6480464 Tretinoin results in increased expression of TMEM51 mRNA CTD PMID:23724009 Tmem51 Rat arsane multiple interactions ISO TMEM51 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of TMEM51 mRNA CTD PMID:39836092 Tmem51 Rat arsenic atom multiple interactions ISO TMEM51 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of TMEM51 mRNA CTD PMID:39836092 Tmem51 Rat atrazine decreases expression ISO TMEM51 (Homo sapiens) 6480464 Atrazine results in decreased expression of TMEM51 mRNA CTD PMID:22378314 Tmem51 Rat belinostat decreases expression ISO TMEM51 (Homo sapiens) 6480464 belinostat results in decreased expression of TMEM51 mRNA CTD PMID:27188386 Tmem51 Rat benzo[a]pyrene increases expression ISO Tmem51 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of TMEM51 mRNA CTD PMID:22228805 Tmem51 Rat benzo[a]pyrene decreases methylation ISO TMEM51 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of TMEM51 promoter CTD PMID:27901495 Tmem51 Rat benzo[a]pyrene affects methylation ISO TMEM51 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of TMEM51 5' UTR CTD PMID:27901495 Tmem51 Rat benzo[a]pyrene diol epoxide I decreases expression ISO TMEM51 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Tmem51 Rat bis(2-ethylhexyl) phthalate increases expression ISO Tmem51 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of TMEM51 mRNA CTD PMID:33754040 Tmem51 Rat bisphenol A increases expression ISO Tmem51 (Mus musculus) 6480464 bisphenol A results in increased expression of TMEM51 mRNA CTD PMID:25270620 Tmem51 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TMEM51 mRNA CTD PMID:25181051 more ... Tmem51 Rat bisphenol F increases expression ISO Tmem51 (Mus musculus) 6480464 bisphenol F results in increased expression of TMEM51 mRNA CTD PMID:30951980 Tmem51 Rat cadmium dichloride increases expression ISO Tmem51 (Mus musculus) 6480464 Cadmium Chloride results in increased expression of TMEM51 mRNA CTD PMID:24982889 Tmem51 Rat caffeine affects phosphorylation ISO TMEM51 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of TMEM51 protein CTD PMID:35688186 Tmem51 Rat carbon nanotube decreases expression ISO Tmem51 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Tmem51 Rat CGP 52608 multiple interactions ISO TMEM51 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TMEM51 gene] CTD PMID:28238834 Tmem51 Rat cobalt dichloride increases expression ISO Tmem51 (Mus musculus) 6480464 cobaltous chloride results in increased expression of TMEM51 mRNA CTD PMID:21139344 Tmem51 Rat copper(II) sulfate affects expression ISO TMEM51 (Homo sapiens) 6480464 Copper Sulfate affects the expression of TMEM51 mRNA CTD PMID:19549813 Tmem51 Rat crocidolite asbestos increases expression ISO Tmem51 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of TMEM51 mRNA CTD PMID:19446018 Tmem51 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of TMEM51 mRNA CTD PMID:21266533 Tmem51 Rat diquat increases expression ISO Tmem51 (Mus musculus) 6480464 Diquat results in increased expression of TMEM51 protein CTD PMID:36851058 Tmem51 Rat doxorubicin decreases expression ISO TMEM51 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of TMEM51 mRNA CTD PMID:29803840 Tmem51 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of TMEM51 mRNA CTD PMID:29391264 Tmem51 Rat epoxiconazole increases expression ISO Tmem51 (Mus musculus) 6480464 epoxiconazole results in increased expression of TMEM51 mRNA CTD PMID:35436446 Tmem51 Rat ethanol increases expression ISO Tmem51 (Mus musculus) 6480464 Ethanol results in increased expression of TMEM51 mRNA CTD PMID:30319688 Tmem51 Rat fenthion decreases expression ISO Tmem51 (Mus musculus) 6480464 Fenthion results in decreased expression of TMEM51 mRNA CTD PMID:34813904 Tmem51 Rat folic acid multiple interactions ISO Tmem51 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TMEM51 mRNA CTD PMID:22206623 Tmem51 Rat FR900359 affects phosphorylation ISO TMEM51 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of TMEM51 protein CTD PMID:37730182 Tmem51 Rat fulvestrant increases methylation ISO TMEM51 (Homo sapiens) 6480464 Fulvestrant results in increased methylation of TMEM51 gene CTD PMID:31601247 Tmem51 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of TMEM51 mRNA CTD PMID:33387578 Tmem51 Rat inulin multiple interactions ISO Tmem51 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of TMEM51 mRNA CTD PMID:36331819 Tmem51 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of TMEM51 gene CTD PMID:35440735 Tmem51 Rat paracetamol affects expression ISO Tmem51 (Mus musculus) 6480464 Acetaminophen affects the expression of TMEM51 mRNA CTD PMID:17562736 Tmem51 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of TMEM51 mRNA CTD PMID:33387578 Tmem51 Rat paracetamol increases expression ISO TMEM51 (Homo sapiens) 6480464 Acetaminophen results in increased expression of TMEM51 mRNA CTD PMID:22230336 Tmem51 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Tmem51 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TMEM51 mRNA more ... CTD PMID:36331819 Tmem51 Rat phenobarbital multiple interactions ISO Tmem51 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of TMEM51 mRNA] CTD PMID:19482888 Tmem51 Rat phenobarbital affects expression ISO Tmem51 (Mus musculus) 6480464 Phenobarbital affects the expression of TMEM51 mRNA CTD PMID:23091169 Tmem51 Rat phenobarbital affects expression ISO TMEM51 (Homo sapiens) 6480464 Phenobarbital affects the expression of TMEM51 mRNA CTD PMID:19159669 Tmem51 Rat phenobarbital increases expression ISO Tmem51 (Mus musculus) 6480464 Phenobarbital results in increased expression of TMEM51 mRNA CTD PMID:19270015 and PMID:19482888 Tmem51 Rat pregnenolone 16alpha-carbonitrile increases expression ISO Tmem51 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of TMEM51 mRNA CTD PMID:28903501 Tmem51 Rat sodium arsenite increases expression ISO TMEM51 (Homo sapiens) 6480464 sodium arsenite results in increased expression of TMEM51 mRNA CTD PMID:29301061 Tmem51 Rat sodium arsenite decreases expression ISO Tmem51 (Mus musculus) 6480464 sodium arsenite results in decreased expression of TMEM51 mRNA CTD PMID:37682722 Tmem51 Rat sodium arsenite multiple interactions ISO TMEM51 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of TMEM51 mRNA CTD PMID:39836092 Tmem51 Rat sodium dichromate decreases expression ISO TMEM51 (Homo sapiens) 6480464 sodium bichromate results in decreased expression of TMEM51 mRNA CTD PMID:17685462 Tmem51 Rat succimer multiple interactions ISO Tmem51 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of TMEM51 mRNA CTD PMID:21641980 Tmem51 Rat sunitinib decreases expression ISO TMEM51 (Homo sapiens) 6480464 Sunitinib results in decreased expression of TMEM51 mRNA CTD PMID:31533062 Tmem51 Rat temozolomide decreases expression ISO TMEM51 (Homo sapiens) 6480464 Temozolomide results in decreased expression of TMEM51 mRNA CTD PMID:31758290 Tmem51 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of TMEM51 mRNA CTD PMID:31150632 Tmem51 Rat titanium dioxide decreases methylation ISO Tmem51 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of TMEM51 promoter CTD PMID:35295148 Tmem51 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of TMEM51 mRNA CTD PMID:33387578 Tmem51 Rat trichostatin A increases expression ISO TMEM51 (Homo sapiens) 6480464 trichostatin A results in increased expression of TMEM51 mRNA CTD PMID:24935251 Tmem51 Rat triptonide increases expression ISO Tmem51 (Mus musculus) 6480464 triptonide results in increased expression of TMEM51 mRNA CTD PMID:33045310 Tmem51 Rat valproic acid affects expression ISO TMEM51 (Homo sapiens) 6480464 Valproic Acid affects the expression of TMEM51 mRNA CTD PMID:25979313
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) all-trans-retinoic acid (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) belinostat (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) dibutyl phthalate (EXP) diquat (ISO) doxorubicin (ISO) endosulfan (EXP) epoxiconazole (ISO) ethanol (ISO) fenthion (ISO) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) gentamycin (EXP) inulin (ISO) methoxychlor (EXP) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) pregnenolone 16alpha-carbonitrile (ISO) sodium arsenite (ISO) sodium dichromate (ISO) succimer (ISO) sunitinib (ISO) temozolomide (ISO) tetrachloromethane (EXP) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triptonide (ISO) valproic acid (ISO)
Tmem51 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 159,608,865 - 159,658,918 (-) NCBI GRCr8 mRatBN7.2 5 154,325,853 - 154,375,882 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 154,325,856 - 154,375,882 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 157,011,201 - 157,061,248 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 158,784,518 - 158,834,563 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 158,773,627 - 158,823,672 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 160,570,510 - 160,620,647 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 160,570,502 - 160,620,334 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 164,280,429 - 164,331,199 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 160,938,672 - 160,988,578 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 152,676,000 - 152,726,010 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
TMEM51 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 15,152,566 - 15,220,478 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 15,152,532 - 15,220,478 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 15,479,062 - 15,546,974 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 15,352,816 - 15,419,459 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 13,961,915 - 14,029,876 (+) NCBI Celera Cytogenetic Map 1 p36.21 NCBI HuRef 1 13,998,854 - 14,066,773 (+) NCBI HuRef CHM1_1 1 15,277,332 - 15,345,401 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 14,596,611 - 14,664,561 (+) NCBI T2T-CHM13v2.0
Tmem51 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 141,758,301 - 141,811,985 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 141,758,303 - 141,811,615 (-) Ensembl GRCm39 Ensembl GRCm38 4 142,030,990 - 142,084,928 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 142,030,992 - 142,084,304 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 141,586,908 - 141,640,219 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 141,303,069 - 141,356,380 (-) NCBI MGSCv36 mm8 Celera 4 143,847,330 - 143,900,826 (-) NCBI Celera Cytogenetic Map 4 D3 NCBI cM Map 4 75.17 NCBI
Tmem51 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955527 2,893,040 - 2,944,542 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955527 2,893,040 - 2,944,542 (-) NCBI ChiLan1.0 ChiLan1.0
TMEM51 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 211,700,268 - 211,763,727 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 210,947,446 - 211,010,889 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 14,293,923 - 14,358,165 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 15,287,723 - 15,351,582 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 15,346,218 - 15,351,584 (+) Ensembl panpan1.1 panPan2
TMEM51 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 82,251,395 - 82,307,008 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 82,252,110 - 82,307,222 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 78,788,717 - 78,844,404 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 82,901,367 - 82,956,874 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 82,901,367 - 82,957,028 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 79,653,343 - 79,709,022 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 80,671,632 - 80,727,356 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 81,736,833 - 81,792,554 (-) NCBI UU_Cfam_GSD_1.0
Tmem51 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 37,129,121 - 37,138,181 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 2,953,925 - 2,963,677 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 2,953,969 - 2,962,963 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TMEM51 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 74,434,050 - 74,486,780 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 74,433,612 - 74,486,784 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 68,868,130 - 68,871,830 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TMEM51 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 117,057,215 - 117,128,428 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 117,057,041 - 117,127,184 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 20,770,529 - 20,842,176 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tmem51
.
Predicted Target Of
Count of predictions: 250 Count of miRNA genes: 167 Interacting mature miRNAs: 188 Transcripts: ENSRNOT00000019171 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 2302369 Scl60 Serum cholesterol level QTL 60 3.13 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 143608201 161165651 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 1300119 Bp180 Blood pressure QTL 180 3.82 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 144358090 157869054 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 1354631 Swd2 Spike wave discharge measurement QTL 2 3.64 0.0002 brain electrophysiology trait (VT:0010557) brain total spike-and-wave discharge duration (CMO:0001740) 5 151113452 164465185 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631263 Cm24 Cardiac mass QTL 24 3.5 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 5 143799107 158428037 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat 631272 Lanf1 Left ventricular atrial natriuretic factor QTL 1 12 heart left ventricle natriuretic peptide A amount (VT:0010596) heart left ventricle natriuretic peptide A level (CMO:0002165) 5 151113452 166875058 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 2313096 Bmd78 Bone mineral density QTL 78 3.1 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 5 144377876 161317411 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298090 Bp155 Blood pressure QTL 155 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 151006154 161165494 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat
RH130064
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 154,325,888 - 154,326,073 (+) MAPPER mRatBN7.2 Rnor_6.0 5 160,570,544 - 160,570,728 NCBI Rnor6.0 Rnor_5.0 5 164,281,894 - 164,282,078 UniSTS Rnor5.0 RGSC_v3.4 5 160,938,705 - 160,938,889 UniSTS RGSC3.4 Celera 5 152,676,033 - 152,676,217 UniSTS Cytogenetic Map 5 q36 UniSTS
RH132592
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 154,352,869 - 154,353,088 (+) MAPPER mRatBN7.2 Rnor_6.0 5 160,597,315 - 160,597,533 NCBI Rnor6.0 Rnor_5.0 5 164,308,475 - 164,308,693 UniSTS Rnor5.0 RGSC_v3.4 5 160,965,655 - 160,965,873 UniSTS RGSC3.4 Celera 5 152,702,695 - 152,702,913 UniSTS RH 3.4 Map 5 1055.9 UniSTS Cytogenetic Map 5 q36 UniSTS
BF386229
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 154,329,173 - 154,329,350 (+) MAPPER mRatBN7.2 Rnor_6.0 5 160,573,829 - 160,574,005 NCBI Rnor6.0 Rnor_5.0 5 164,285,179 - 164,285,355 UniSTS Rnor5.0 RGSC_v3.4 5 160,941,990 - 160,942,166 UniSTS RGSC3.4 Celera 5 152,679,318 - 152,679,494 UniSTS RH 3.4 Map 5 1057.6 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000019171 ⟹ ENSRNOP00000019171
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 154,325,856 - 154,375,882 (-) Ensembl Rnor_6.0 Ensembl 5 160,570,511 - 160,620,334 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000089981 ⟹ ENSRNOP00000072618
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 160,570,502 - 160,619,650 (-) Ensembl
RefSeq Acc Id:
NM_001109273 ⟹ NP_001102743
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 159,608,866 - 159,658,891 (-) NCBI mRatBN7.2 5 154,325,856 - 154,375,882 (-) NCBI Rnor_6.0 5 160,570,511 - 160,620,334 (-) NCBI Rnor_5.0 5 164,280,429 - 164,331,199 (-) NCBI RGSC_v3.4 5 160,938,672 - 160,988,578 (-) RGD Celera 5 152,676,000 - 152,726,010 (-) RGD
Sequence:
CCCGGGCTGCCCAAGGACTTCTCAGGCCTTTAACTTCAAAGAGCTGGGCGCGCACCCACGAAGCCACCCAGGTCGGAATTCAGAGCTGGCAGGAGACGCAGATCCGTGCCTGGAGTCGTGGGGTTCCT
hide sequence
RefSeq Acc Id:
XM_006239313 ⟹ XP_006239375
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 159,608,865 - 159,658,310 (-) NCBI mRatBN7.2 5 154,325,853 - 154,375,250 (-) NCBI Rnor_6.0 5 160,570,510 - 160,619,597 (-) NCBI Rnor_5.0 5 164,280,429 - 164,331,199 (-) NCBI
Sequence:
GTGATTGCCTGGGGTGGGGGTGTCGCGGAACCCCCAGCCCCGGGCCTCCGGACAGAGACCCGGCGTGGCTCGCTGCCTTCGGGATCTCTCATCCGCTCGGCCCACCCCAGCCATTTGAAGAGAGTCAT
hide sequence
RefSeq Acc Id:
XM_006239314 ⟹ XP_006239376
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 159,608,865 - 159,658,918 (-) NCBI mRatBN7.2 5 154,326,509 - 154,375,687 (-) NCBI Rnor_6.0 5 160,571,164 - 160,620,647 (-) NCBI Rnor_5.0 5 164,280,429 - 164,331,199 (-) NCBI
Sequence:
AACCTAGGCCTGGTTCAGAGTAAGGATACAAGATGTTGTCAGCAGTTACTCTTGTGCTCTGAGC
hide sequence
RefSeq Acc Id:
XM_006239315 ⟹ XP_006239377
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 159,608,865 - 159,658,299 (-) NCBI mRatBN7.2 5 154,326,509 - 154,375,042 (-) NCBI Rnor_6.0 5 160,571,164 - 160,619,282 (-) NCBI Rnor_5.0 5 164,280,429 - 164,331,199 (-) NCBI
Sequence:
ACCTGGGCACTGGTGCTTTTGAGAGGAAAGAACTTGGATAGGGCACTGAGCCGGCCGCGTGAGCCCCTGTCCTTGTAATGTGGGAGTGGACACTATCTACTCTTAACTTCCTTCTGACTGTTACCGCA
hide sequence
RefSeq Acc Id:
XM_063288298 ⟹ XP_063144368
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 159,608,865 - 159,658,886 (-) NCBI
RefSeq Acc Id:
XM_063288299 ⟹ XP_063144369
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 159,608,865 - 159,628,841 (-) NCBI
RefSeq Acc Id:
NP_001102743 ⟸ NM_001109273
- UniProtKB:
D4AE69 (UniProtKB/TrEMBL), A6ITY1 (UniProtKB/TrEMBL)
- Sequence:
MMAQSKANGSHYALTAIGLGMLVLGVIMAMWNLVPGFSPADKPTAQGNKTEGGGGILKSKTFSVAYVLVGAGVMLLLLSICLSIRDKRKLRQSEELARIQQQAGAVPPSQEEDSQEEEEEASSRYYVP
hide sequence
RefSeq Acc Id:
XP_006239376 ⟸ XM_006239314
- Peptide Label:
isoform X1
- UniProtKB:
D4AE69 (UniProtKB/TrEMBL), A6ITY1 (UniProtKB/TrEMBL)
- Sequence:
MMAQSKANGSHYALTAIGLGMLVLGVIMAMWNLVPGFSPADKPTAQGNKTEGGGGILKSKTFSVAYVLVGAGVMLLLLSICLSIRDKRKLRQSEELARIQQQAGAVPPSQEEDSQEEEEEASSRYYVP
hide sequence
RefSeq Acc Id:
XP_006239375 ⟸ XM_006239313
- Peptide Label:
isoform X1
- UniProtKB:
D4AE69 (UniProtKB/TrEMBL), A6ITY1 (UniProtKB/TrEMBL)
- Sequence:
MMAQSKANGSHYALTAIGLGMLVLGVIMAMWNLVPGFSPADKPTAQGNKTEGGGGILKSKTFSVAYVLVGAGVMLLLLSICLSIRDKRKLRQSEELARIQQQAGAVPPSQEEDSQEEEEEASSRYYVP
hide sequence
RefSeq Acc Id:
XP_006239377 ⟸ XM_006239315
- Peptide Label:
isoform X1
- UniProtKB:
D4AE69 (UniProtKB/TrEMBL), A6ITY1 (UniProtKB/TrEMBL)
- Sequence:
MMAQSKANGSHYALTAIGLGMLVLGVIMAMWNLVPGFSPADKPTAQGNKTEGGGGILKSKTFSVAYVLVGAGVMLLLLSICLSIRDKRKLRQSEELARIQQQAGAVPPSQEEDSQEEEEEASSRYYVP
hide sequence
Ensembl Acc Id:
ENSRNOP00000072618 ⟸ ENSRNOT00000089981
Ensembl Acc Id:
ENSRNOP00000019171 ⟸ ENSRNOT00000019171
RefSeq Acc Id:
XP_063144368 ⟸ XM_063288298
- Peptide Label:
isoform X1
- UniProtKB:
A6ITY1 (UniProtKB/TrEMBL), D4AE69 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063144369 ⟸ XM_063288299
- Peptide Label:
isoform X1
- UniProtKB:
A6ITY1 (UniProtKB/TrEMBL), D4AE69 (UniProtKB/TrEMBL)
RGD ID: 13694247 Promoter ID: EPDNEW_R4764 Type: initiation region Name: Tmem51_1 Description: transmembrane protein 51 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 160,619,697 - 160,619,757 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-06
Tmem51
transmembrane protein 51
RGD1565452_predicted
similar to BC003277 protein (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-07
RGD1565452_predicted
similar to BC003277 protein (predicted)
LOC500578
similar to BC003277 protein
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC500578
similar to BC003277 protein
Symbol and Name status set to provisional
70820 PROVISIONAL
