Advanced Search (OLGA)

Gene: Clec2l (C-type lectin domain family 2, member L) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Clec2l

Name:

C-type lectin domain family 2, member L

RGD ID:

1565373

Description:

Predicted to enable carbohydrate binding activity. Predicted to be located in membrane. Orthologous to human CLEC2L (C-type lectin domain family 2 member L); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

C-type lectin domain family 2 member L; C-type lectin domain family, member L; CD69-like protein; LOC296985; RGD1565373; similar to CD69 antigen (p60, early T-cell activation antigen)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	68,359,021 - 68,381,431 (+)	NCBI		GRCr8
mRatBN7.2	4	67,392,118 - 67,414,539 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	67,397,873 - 67,414,537 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	72,339,727 - 72,355,976 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	68,260,842 - 68,277,091 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	66,658,713 - 66,675,259 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	66,404,880 - 66,421,656 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	66,405,166 - 66,421,654 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	66,215,888 - 66,232,497 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	66,232,208 - 66,248,866 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	62,414,466 - 62,430,668 (+)	NCBI		Celera
Cytogenetic Map	4	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Clec2l	Rat	pleomorphic xanthoastrocytoma		ISO	CLEC2L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Pleomorphic xanthoastrocytoma	ClinVar	PMID:28299358
Clec2l	Rat	RASopathy		ISO	CLEC2L (Homo sapiens)	8554872	ClinVar Annotator: match by term: RASopathy	ClinVar	PMID:12414817 more ...

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Clec2l	Rat	2,3',4,4',5-Pentachlorobiphenyl	increases expression	ISO	Clec2l (Mus musculus)	6480464	2 more ...	CTD	PMID:31388691
Clec2l	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of CLEC2L mRNA	CTD	PMID:32109520
Clec2l	Rat	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	EXP		6480464	2 more ...	CTD	PMID:32109520
Clec2l	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	Clec2l (Mus musculus)	6480464	2 more ...	CTD	PMID:38648751
Clec2l	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of CLEC2L mRNA	CTD	PMID:24780913
Clec2l	Rat	aflatoxin B1	increases expression	EXP		6480464	Aflatoxin B1 results in increased expression of CLEC2L mRNA	CTD	PMID:23630614
Clec2l	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CLEC2L mRNA	CTD	PMID:35163327
Clec2l	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of CLEC2L mRNA	CTD	PMID:38685447
Clec2l	Rat	benzo[a]pyrene	affects methylation	ISO	CLEC2L (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of CLEC2L polyA tail	CTD	PMID:30157460
Clec2l	Rat	benzo[a]pyrene	increases methylation	ISO	Clec2l (Mus musculus)	6480464	Benzo(a)pyrene results in increased methylation of CLEC2L intron	CTD	PMID:27901495
Clec2l	Rat	benzo[a]pyrene	increases methylation	ISO	CLEC2L (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of CLEC2L promoter	CTD	PMID:27901495
Clec2l	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	Clec2l (Mus musculus)	6480464	Diethylhexyl Phthalate results in decreased expression of CLEC2L mRNA	CTD	PMID:33754040
Clec2l	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of CLEC2L mRNA	CTD	PMID:25181051
Clec2l	Rat	bisphenol A	increases expression	ISO	Clec2l (Mus musculus)	6480464	bisphenol A results in increased expression of CLEC2L mRNA	CTD	PMID:32156529
Clec2l	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of CLEC2L gene	CTD	PMID:28505145
Clec2l	Rat	cadmium dichloride	increases expression	EXP		6480464	Cadmium Chloride results in increased expression of CLEC2L mRNA	CTD	PMID:21297351
Clec2l	Rat	chlorpyrifos	decreases expression	ISO	Clec2l (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of CLEC2L mRNA	CTD	PMID:37019170
Clec2l	Rat	decabromodiphenyl ether	multiple interactions	EXP		6480464	[Flame Retardants co-treated with pentabromodiphenyl ether co-treated with decabromobiphenyl ether co-treated with hexabromocyclododecane] results in increased expression of CLEC2L mRNA	CTD	PMID:32207525
Clec2l	Rat	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of CLEC2L mRNA	CTD	PMID:24893172
Clec2l	Rat	dicrotophos	increases expression	ISO	CLEC2L (Homo sapiens)	6480464	dicrotophos results in increased expression of CLEC2L mRNA	CTD	PMID:28302478
Clec2l	Rat	ketamine	increases expression	EXP		6480464	Ketamine results in increased expression of CLEC2L mRNA	CTD	PMID:20080153
Clec2l	Rat	lead(0)	affects expression	ISO	CLEC2L (Homo sapiens)	6480464	Lead affects the expression of CLEC2L mRNA	CTD	PMID:28903495
Clec2l	Rat	paraquat	decreases expression	EXP		6480464	Paraquat results in decreased expression of CLEC2L mRNA	CTD	PMID:32680482
Clec2l	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CLEC2L mRNA	CTD	PMID:35163327
Clec2l	Rat	potassium dichromate	decreases expression	ISO	Clec2l (Mus musculus)	6480464	Potassium Dichromate results in decreased expression of CLEC2L mRNA	CTD	PMID:23608068
Clec2l	Rat	triclosan	decreases expression	ISO	CLEC2L (Homo sapiens)	6480464	Triclosan results in decreased expression of CLEC2L mRNA	CTD	PMID:30510588
Clec2l	Rat	triptonide	increases expression	ISO	Clec2l (Mus musculus)	6480464	triptonide results in increased expression of CLEC2L mRNA	CTD	PMID:33045310
Clec2l	Rat	trovafloxacin	decreases expression	ISO	Clec2l (Mus musculus)	6480464	trovafloxacin results in decreased expression of CLEC2L mRNA	CTD	PMID:35537566
Clec2l	Rat	valproic acid	increases methylation	ISO	CLEC2L (Homo sapiens)	6480464	Valproic Acid results in increased methylation of CLEC2L gene	CTD	PMID:29154799

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Clec2l	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Clec2l	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Clec2l	Rat	carbohydrate binding	enables	IEA	UniProtKB-KW:KW-0430	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	GOA pipeline	RGD automated data pipeline
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932

Clec2l
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	68,359,021 - 68,381,431 (+)	NCBI		GRCr8
mRatBN7.2	4	67,392,118 - 67,414,539 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	67,397,873 - 67,414,537 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	72,339,727 - 72,355,976 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	68,260,842 - 68,277,091 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	66,658,713 - 66,675,259 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	66,404,880 - 66,421,656 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	66,405,166 - 66,421,654 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	66,215,888 - 66,232,497 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	66,232,208 - 66,248,866 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	62,414,466 - 62,430,668 (+)	NCBI		Celera
Cytogenetic Map	4	q23	NCBI

CLEC2L
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	139,523,685 - 139,544,985 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	139,523,685 - 139,544,985 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	139,208,431 - 139,229,731 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	138,872,371 - 138,879,628 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	7	133,946,855 - 133,967,908 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI
HuRef	7	133,519,203 - 133,540,255 (+)	NCBI		HuRef
CHM1_1	7	139,142,976 - 139,163,946 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	140,836,984 - 140,858,283 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	138,553,223 - 138,574,276 (+)	NCBI

Clec2l
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	38,640,004 - 38,657,800 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	38,640,002 - 38,657,800 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	38,663,069 - 38,680,865 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	38,663,067 - 38,680,865 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	38,613,069 - 38,630,864 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	38,586,293 - 38,610,472 (+)	NCBI		MGSCv36	mm8
Celera	6	38,644,226 - 38,662,211 (+)	NCBI		Celera
Cytogenetic Map	6	B1	NCBI
cM Map	6	17.85	NCBI

CLEC2L
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	176,324,248 - 176,345,556 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	28,334,505 - 28,355,811 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	131,468,864 - 131,490,171 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	143,950,831 - 143,974,212 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	143,953,455 - 143,973,570 (+)	Ensembl	panpan1.1		panPan2

CLEC2L
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	16	9,263,443 - 9,287,301 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	16	9,263,450 - 9,270,531 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	16	10,106,382 - 10,122,384 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	16	9,183,481 - 9,199,709 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	16	9,183,488 - 9,200,129 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	16	9,133,994 - 9,149,997 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	16	8,978,287 - 8,994,290 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	16	9,047,230 - 9,063,458 (-)	NCBI		UU_Cfam_GSD_1.0

Clec2l
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	15,428,451 - 15,435,003 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936592	3,784,752 - 3,790,750 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936592	3,784,800 - 3,791,352 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CLEC2L
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	10,160,032 - 10,176,289 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	18	10,155,299 - 10,176,343 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

CLEC2L
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	108,272,777 - 108,294,068 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666156	35,879 - 131,123 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Clec2l
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624765	19,893,864 - 19,905,771 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624765	19,893,899 - 19,903,774 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Clec2l
116 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	420
Count of miRNA genes:	207
Interacting mature miRNAs:	232
Transcripts:	ENSRNOT00000067097
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
1549843	Bw53	Body weight QTL 53		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	103194791	Rat
61445	Strs3	Sensitivity to stroke QTL 3	3		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	4	40433388	85433388	Rat
6893678	Bw108	Body weight QTL 108	2.6	0.006	body mass (VT:0001259)	body weight (CMO:0000012)	4	43457976	88457976	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	26775591	168368347	Rat
1358363	Sradr3	Stress Responsive Adrenal Weight QTL 3	6.19		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	57486946	102486946	Rat
61336	Bp21	Blood pressure QTL 21	4.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	57114705	78881294	Rat
1549839	Bw52	Body weight QTL 52		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	115089733	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	26907285	75585128	Rat
61475	Aia2	Adjuvant induced arthritis QTL 2	5.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	39505275	73892441	Rat
8694439	Bw168	Body weight QTL 168	9.57	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	40433414	85433414	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	29494195	81006281	Rat
2317577	Eae24	Experimental allergic encephalomyelitis QTL 24			nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	4	66993185	72752834	Rat
6909122	Insul22	Insulin level QTL 22	4.63		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	4	26907285	75585128	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
2300179	Bmd50	Bone mineral density QTL 50	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	4	60928534	105928534	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	4	62933508	114921294	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	39524264	116179656	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
1578657	Bss12	Bone structure and strength QTL 12	8.9		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	4	60220938	105220938	Rat
1578658	Bss13	Bone structure and strength QTL 13	8		femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	4	60220938	105220938	Rat
4889969	Bss96	Bone structure and strength QTL 96	4.9		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	4	56647776	78882945	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
4889972	Bss97	Bone structure and strength QTL 97	5.6		tibia size trait (VT:0100001)	tibia total bone volume (CMO:0001724)	4	56647776	78882945	Rat
6478684	Anxrr30	Anxiety related response QTL 30		0.00087	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
5685012	Bmd87	Bone mineral density QTL 87	5.1		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	4	56647776	78882945	Rat
5685009	Bmd86	Bone mineral density QTL 86	3.7		tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	4	56647776	78882945	Rat
1331807	Rf31	Renal function QTL 31	2.988		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	4	39524264	74726312	Rat
8552782	Vie1	Viral induced encephalitis QTL 1	26.4		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
634311	Sach7	Saccharin preference QTL 7			taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	57114432	81266970	Rat
2306547	Iddm38	Insulin dependent diabetes mellitus QTL 38			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	67386669	70362197	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	10814170	91360527	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
6478772	Anxrr49	Anxiety related response QTL 49		0.15488	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
2312569	Pur19	Proteinuria QTL 19	3.4	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	4	65882107	96130297	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	36303261	103194984	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
8552801	Bw143	Body weight QTL 143	7.3		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	34430484	82490359	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
8552807	Vie4	Viral induced encephalitis QTL 4	7.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	62933508	82490359	Rat
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5214602	78882945	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	62277855	128289560	Rat
631651	Bp124	Blood pressure QTL 124	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	62879517	107879517	Rat
8552809	Vie5	Viral induced encephalitis QTL 5	25.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1558651	Swd3	Spike wave discharge measurement QTL 3	4.62	0.000024	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	4	58432133	92991462	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	56698790	126192555	Rat
631546	Bp86	Blood pressure QTL 86	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	57114432	91360801	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
6478743	Anxrr40	Anxiety related response QTL 40		0.83076	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
7394826	Bw126	Body weight QTL 126		0.002	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	62933269	87483707	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	32583980	114627242	Rat
631671	Iddm11	Insulin dependent diabetes mellitus QTL 11	3.6	0.0012	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	58635877	78886137	Rat

D4Rat102

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	4	68,353,567 - 68,353,823 (+)	Marker Load Pipeline
mRatBN7.2	4	67,386,669 - 67,386,927 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	66,394,000 - 66,394,255	NCBI	Rnor6.0
Rnor_5.0	4	66,205,169 - 66,205,424	UniSTS	Rnor5.0
RGSC_v3.4	4	66,220,947 - 66,221,203	RGD	RGSC3.4
RGSC_v3.4	4	66,220,948 - 66,221,203	UniSTS	RGSC3.4
RGSC_v3.1	4	66,497,078 - 66,497,333	RGD
Celera	4	62,404,267 - 62,404,518	UniSTS
RH 3.4 Map	4	402.64	RGD
RH 3.4 Map	4	402.64	UniSTS
RH 2.0 Map	4	443.9	RGD
SHRSP x BN Map	4	34.02	RGD
FHH x ACI Map	4	44.6799	RGD
Cytogenetic Map	4	q22	UniSTS

RH139182

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	67,414,313 - 67,414,536 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	66,421,431 - 66,421,653	NCBI	Rnor6.0
Rnor_5.0	4	66,232,274 - 66,232,496	UniSTS	Rnor5.0
RGSC_v3.4	4	66,248,643 - 66,248,865	UniSTS	RGSC3.4
Celera	4	62,430,445 - 62,430,667	UniSTS
Cytogenetic Map	4	q22	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001044233	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592533	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107295	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC161812	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ630549	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000067097 ⟹ ENSRNOP00000060718

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	67,397,873 - 67,414,537 (+)	Ensembl
Rnor_6.0 Ensembl	4	66,405,306 - 66,421,654 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000077486 ⟹ ENSRNOP00000070445

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	4	66,405,166 - 66,421,654 (+)	Ensembl

RefSeq Acc Id:

NM_001044233 ⟹ NP_001037698

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	68,365,160 - 68,381,431 (+)	NCBI
mRatBN7.2	4	67,398,266 - 67,414,537 (+)	NCBI
Rnor_6.0	4	66,405,166 - 66,421,654 (+)	NCBI
Rnor_5.0	4	66,215,888 - 66,232,497 (+)	NCBI
RGSC_v3.4	4	66,232,208 - 66,248,866 (+)	RGD
Celera	4	62,414,466 - 62,430,668 (+)	RGD

Sequence:

show sequence

ATGGAGCCGGCCAGAGAGCCCCCCGCACGCGCTCGCCCGCCGCCCCCGGCCGCTCGCCCCGCGCCCGCTGCGCCCAGGCCACGCTCTCCAGCCGAGGCAGAGGCCCGAGGCCCAGAGGGGCTGCTGAG
GCGATCCGGGTCTGGCTATGAGGGCAGCACCAGCTGGAAGGCGGCCTTGGAGGACACCACCACACGCCTTCTGCTGGGAGCCATTGCAGTCCTTCTGTTTGCCATTCTGGTGGTGATGAGCATCCTGG
CTTCCAAGGGCTGCATCAAGTGTGAGACGCCTTGCCCAGAGGACTGGCTGCTCTACGGAAGGAAATGCTACTACTTCTCCGAGGAGCCTAGAGACTGGAATACAGGACGGCAGTACTGCCATACCCAC
GAGGCCGCGCTGGCTGTGATCCAGAGCCAGAAAGAACTGGAATTTATGTTCAAGTTCACACGGAGGGAGCCCTGGATCGGCCTGCGCAGAGTTGGGGACGACTTCCACTGGGTCAATGGGGACCCGTT
TGACCCAGACACATTCACCATCTCGGGTACGGGCGAGTGCGTCTTTGTGGAGCCCACCAGGCTGGTGTCAACAGAGTGTCTGACGACCCGTCCCTGGGTGTGCAGCAAGATGGCCTACACGTGATGTG
GCTCAGGCTGGAGGTGGCCCCTGTGCCTAGGCCCAAGGGCAATGTCCGTCCCACAACCTGCTTCTAACAGGAGCCGCCACCCTCTCTAAATGGAAGTAGTGGGGAGGGTGGCCTCTGCCTGTCCCCTT
TCAGGCTCCAGAGCTCTGCAAGGCCTCTGCCTGTCCCCTTTCAGGCTCCAGAGCTCTGCAAGGCCTCTGCCTGTCCCCTTTCAGGCTCCAGAGCTCTGCAAGGCCTCTGCCTGTCCCCTTTCAGGCTC
CAGAGCTCTGCAAGGCCTCTGCCTGTCCCCTTTCAGGCTCCAGAGCTCTGCAAGGCCTCTGCCTGTCCCCTTTCAGGCTCCAGAGCTCTGCAAGGCCTTGGTTTCTTTATCCCCAGGCAGGTCCTGTG
GCCTAGCAGTTATATCTCATATGCTAAGTAGTGTAGACATCTTGCCCCATACACACAAGCACACACGTGTACACGCATGTACACACACAACACACATGCAGGCTCTTCTTAGCAGGTCACCCTTCCTT
GGCTCTGCCTAGAACCTTCCCCACTGCAGCCCTGGTGCTTCTGGGCAGATGGGGGCTGACATGGGTTGTCTGACTTTTGGCCCAGCCTCCTGCCCTCCCCAGTGGCTTCTCTGAGAAGCTGGGTGAGG
CAGGCAGGAACAGCTTCCCCCATGCGTTGGAGAGAACAGCCCGGAGCTGGAGGCTGCTCTATCCCTGCCTTCCCAGGGTCCTCAGGCAGGGCCCCTGCTGTGCTGTGGTGCTGTCCTATCGGTCACTA
ATGGAATAAAGGCTGCGTCTCT

hide sequence

RefSeq Acc Id:

XM_017592533 ⟹ XP_017448022

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	68,364,823 - 68,381,431 (+)	NCBI
mRatBN7.2	4	67,397,926 - 67,414,539 (+)	NCBI
Rnor_6.0	4	66,404,880 - 66,421,656 (+)	NCBI

Sequence:

show sequence

GGGGCTGGTGACCTGAGCTGTCCTCTCTCTCCGCAACCCCGCCCGCGGTCGCGGCTCCCTCGCA
GCCCCGACTCCTCCCCCGTGCGGGGCTCGGCGCGCAGGCTGCGGCGCGCACGGCGGGGACCGGAGCGTCTCCGGCGCGGGGAGCCGGGCTCAGCCCCGGCCTGCGGACGCCGCGGCCCCGGAGCACCA
AGCCGGCCTGGGGGGCCCGCGGGGCGCGCGCAGCGCCGAGTGCGCCTGGGGCCGGGCTCCGCTGCCGGGTGCAGGAGCGCGCGCGCGTCGCGGAATGGAGCCGGCCAGAGAGCCCCCCGCACGCGCTC
GCCCGCCGCCCCCGGCCGCTCGCCCCGCGCCCGCTGCGCCCAGGCCACGCTCTCCAGCCGAGGCAGAGGCCCGAGGCCCAGAGGGGCTGCTGAGGCGATCCGGGTCTGGCTATGAGGGCAGCACCAGC
TGGAAGGCGGCCTTGGAGGCTTCCAAGGGCTGCATCAAGTGTGAGACGCCTTGCCCAGAGGACTGGCTGCTCTACGGAAGGAAATGCTACTACTTCTCCGAGGAGCCTAGAGACTGGAATACAGGACG
GCAGTACTGCCATACCCACGAGGCCGCGCTGGCTGTGATCCAGAGCCAGAAAGAACTGGAATTTATGTTCAAGTTCACACGGAGGGAGCCCTGGATCGGCCTGCGCAGAGTTGGGGACGACTTCCACT
GGGTCAATGGGGACCCGTTTGACCCAGACACATTCACCATCTCGGGTACGGGCGAGTGCGTCTTTGTGGAGCCCACCAGGCTGGTGTCAACAGAGTGTCTGACGACCCGTCCCTGGGTGTGCAGCAAG
ATGGCCTACACGTGATGTGGCTCAGGCTGGAGGTGGCCCCTGTGCCTAGGCCCAAGGGCAATGTCCGTCCCACAACCTGCTTCTAACAGGAGCCGCCACCCTCTCTAAATGGAAGTAGTGGGGAGGGT
GGCCTCTGCCTGTCCCCTTTCAGGCTCCAGAGCTCTGCAAGGCCTCTGCCTGTCCCCTTTCAGGCTCCAGAGCTCTGCAAGGCCTCTGCCTGTCCCCTTTCAGGCTCCAGAGCTCTGCAAGGCCTCTG
CCTGTCCCCTTTCAGGCTCCAGAGCTCTGCAAGGCCTCTGCCTGTCCCCTTTCAGGCTCCAGAGCTCTGCAAGGCCTCTGCCTGTCCCCTTTCAGGCTCCAGAGCTCTGCAAGGCCTTGGTTTCTTTA
TCCCCAGGCAGGTCCTGTGGCCTAGCAGTTATATCTCATATGCTAAGTAGTGTAGACATCTTGCCCCATACACACAAGCACACACGTGTACACGCATGTACACACACAACACACATGCAGGCTCTTCT
TAGCAGGTCACCCTTCCTTGGCTCTGCCTAGAACCTTCCCCACTGCAGCCCTGGTGCTTCTGGGCAGATGGGGGCTGACATGGGTTGTCTGACTTTTGGCCCAGCCTCCTGCCCTCCCCAGTGGCTTC
TCTGAGAAGCTGGGTGAGGCAGGCAGGAACAGCTTCCCCCATGCGTTGGAGAGAACAGCCCGGAGCTGGAGGCTGCTCTATCCCTGCCTTCCCAGGGTCCTCAGGCAGGGCCCCTGCTGTGCTGTGGT
GCTGTCCTATCGGTCACTAATGGAATAAAGGCTGCGTCTCTGA

hide sequence

RefSeq Acc Id:

XM_039107295 ⟹ XP_038963223

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	68,359,021 - 68,381,431 (+)	NCBI
mRatBN7.2	4	67,392,118 - 67,414,539 (+)	NCBI


Protein RefSeqs	NP_001037698	(Get FASTA)	NCBI Sequence Viewer
	XP_017448022	(Get FASTA)	NCBI Sequence Viewer
	XP_038963223	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI61812	(Get FASTA)	NCBI Sequence Viewer
	ABG00196	(Get FASTA)	NCBI Sequence Viewer
	EDM15366	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000060718.3
	ENSRNOP00000099071
	ENSRNOP00000103793
GenBank Protein	Q0ZCA7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001037698 ⟸ NM_001044233

- UniProtKB:

Q0ZCA7 (UniProtKB/Swiss-Prot), A6IES9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEPAREPPARARPPPPAARPAPAAPRPRSPAEAEARGPEGLLRRSGSGYEGSTSWKAALEDTTTRLLLGAIAVLLFAILVVMSILASKGCIKCETPCPEDWLLYGRKCYYFSEEPRDWNTGRQYCHTH
EAALAVIQSQKELEFMFKFTRREPWIGLRRVGDDFHWVNGDPFDPDTFTISGTGECVFVEPTRLVSTECLTTRPWVCSKMAYT

hide sequence

RefSeq Acc Id:	XP_017448022 ⟸ XM_017592533
- Peptide Label:	isoform X1
- Sequence:	show sequence MEPAREPPARARPPPPAARPAPAAPRPRSPAEAEARGPEGLLRRSGSGYEGSTSWKAALEASKGCIKCETPCPEDWLLYGRKCYYFSEEPRDWNTGRQYCHTHEAALAVIQSQKELEFMFKFTRREPW IGLRRVGDDFHWVNGDPFDPDTFTISGTGECVFVEPTRLVSTECLTTRPWVCSKMAYT hide sequence

Ensembl Acc Id:

ENSRNOP00000060718 ⟸ ENSRNOT00000067097

Ensembl Acc Id:

ENSRNOP00000070445 ⟸ ENSRNOT00000077486

RefSeq Acc Id:	XP_038963223 ⟸ XM_039107295
- Peptide Label:	isoform X2

Protein Domains

C-type lectin

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q0ZCA7-F1-model_v2	AlphaFold	Q0ZCA7	1-211	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-45203	BioCyc
Ensembl Genes	ENSRNOG00000029644	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000067097.3	UniProtKB/Swiss-Prot
	ENSRNOT00000123376	ENTREZGENE
	ENSRNOT00000171496	ENTREZGENE
Gene3D-CATH	3.10.100.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7131290	IMAGE-MGC_LOAD
InterPro	C-type_lectin-like	UniProtKB/Swiss-Prot
	C-type_lectin-like/link_sf	UniProtKB/Swiss-Prot
	CTDL_fold	UniProtKB/Swiss-Prot
	NKR-like_CTLD	UniProtKB/Swiss-Prot
KEGG Report	rno:296985	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:187249	IMAGE-MGC_LOAD
NCBI Gene	296985	ENTREZGENE
PANTHER	C-TYPE LECTIN DOMAIN FAMILY 2 MEMBER L	UniProtKB/Swiss-Prot
	C-TYPE LECTIN DOMAIN FAMILY 2 MEMBER L	UniProtKB/Swiss-Prot
Pfam	Lectin_C	UniProtKB/Swiss-Prot
PhenoGen	Clec2l	PhenoGen
PROSITE	C_TYPE_LECTIN_1	UniProtKB/Swiss-Prot
	C_TYPE_LECTIN_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000029644	RatGTEx
SMART	CLECT	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF56436	UniProtKB/Swiss-Prot
UniProt	A0A0H2UI15_RAT	UniProtKB/TrEMBL
	A6IES9	ENTREZGENE, UniProtKB/TrEMBL
	B1WBM7_RAT	UniProtKB/TrEMBL
	CLC2L_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-29	Clec2l	C-type lectin domain family 2, member L	Clec2l	C-type lectin domain family, member L	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-19	Clec2l	C-type lectin domain family, member L	RGD1565373	similar to CD69 antigen (p60, early T-cell activation antigen)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1565373	similar to CD69 antigen (p60, early T-cell activation antigen)	RGD1565373_predicted	similar to CD69 antigen (p60, early T-cell activation antigen) (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1565373_predicted	similar to CD69 antigen (p60, early T-cell activation antigen) (predicted)	LOC296985	similar to CD69 antigen (p60, early T-cell activation antigen)	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC296985	similar to CD69 antigen (p60, early T-cell activation antigen)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar