Advanced Search (OLGA)

Gene: C20h21orf58 (similar to human chromosome 21 open reading frame 58) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

C20h21orf58

Name:

similar to human chromosome 21 open reading frame 58

RGD ID:

1564149

Description:

Orthologous to human C21orf58 (chromosome 21 open reading frame 58); INTERACTS WITH 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC499419; LOC499419; MGC156707; RGD1564149; similar to Protein C21orf58; uncharacterized protein C21orf58 homolog; uncharacterized protein LOC499419

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	12,165,853 - 12,187,271 (-)	NCBI		GRCr8
mRatBN7.2	20	12,167,279 - 12,188,665 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	12,175,442 - 12,187,017 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	12,870,964 - 12,882,529 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	12,231,887 - 12,243,458 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	12,703,666 - 12,715,231 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	12,927,310 - 12,938,891 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	12,927,320 - 12,938,891 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	15,085,285 - 15,096,866 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	12,591,067 - 12,602,648 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	20	13,673,278 - 13,684,859 (-)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
C20h21orf58	Rat	autistic disorder		ISO	C21orf58 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autism	ClinVar	PMID:21681106 and PMID:30208311
C20h21orf58	Rat	Axenfeld-Rieger syndrome type 3		ISO	C21orf58 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Axenfeld-Rieger syndrome type 3	ClinVar	PMID:11170889 and PMID:21681106
C20h21orf58	Rat	cataract 9 multiple types		ISO	C21orf58 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Cataract 9 multiple types	ClinVar	PMID:28492532
C20h21orf58	Rat	developmental and epileptic encephalopathy 30		ISO	C21orf58 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Developmental and epileptic encephalopathy and 30	ClinVar	PMID:28492532 and PMID:8596935
C20h21orf58	Rat	homocystinuria		ISO	C21orf58 (Homo sapiens)	8554872	ClinVar Annotator: match by term: HYPERHOMOCYSTEINEMIA more ...	ClinVar	PMID:10338090 more ...
C20h21orf58	Rat	primary ciliary dyskinesia		ISO	C21orf58 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Primary ciliary dyskinesia	ClinVar	PMID:28492532
C20h21orf58	Rat	progressive myoclonus epilepsy		ISO	C21orf58 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Progressive myoclonic epilepsy	ClinVar	PMID:28492532 and PMID:8596935

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
C20h21orf58	Rat	1,2-dichloroethane	increases expression	ISO	C21orf58 (Homo sapiens)	6480464	ethylene dichloride results in increased expression of C21ORF58 mRNA alternative form	CTD	PMID:37028497
C20h21orf58	Rat	17beta-estradiol	decreases expression	ISO	C21orf58 (Homo sapiens)	6480464	Estradiol results in decreased expression of C21ORF58 mRNA	CTD	PMID:31614463
C20h21orf58	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of C20H21ORF58 mRNA	CTD	PMID:36041667
C20h21orf58	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of C20H21ORF58 mRNA	CTD	PMID:25825206
C20h21orf58	Rat	acrylamide	decreases expression	ISO	C21orf58 (Homo sapiens)	6480464	Acrylamide results in decreased expression of C21ORF58 mRNA	CTD	PMID:32763439
C20h21orf58	Rat	all-trans-retinoic acid	decreases expression	ISO	C21orf58 (Homo sapiens)	6480464	Tretinoin results in decreased expression of C21ORF58 mRNA	CTD	PMID:33167477
C20h21orf58	Rat	antirheumatic drug	increases expression	ISO	C21orf58 (Homo sapiens)	6480464	Antirheumatic Agents results in increased expression of C21ORF58 mRNA	CTD	PMID:24449571
C20h21orf58	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of C20H21ORF58 mRNA and bisphenol A results in decreased expression of C21ORF58 mRNA	CTD	PMID:25181051 and PMID:34947998
C20h21orf58	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of C20H21ORF58 mRNA	CTD	PMID:36041667
C20h21orf58	Rat	bisphenol A	decreases methylation	ISO	C21orf58 (Homo sapiens)	6480464	bisphenol A results in decreased methylation of C21ORF58 gene	CTD	PMID:31601247
C20h21orf58	Rat	bisphenol A	decreases expression	ISO	C21orf58 (Homo sapiens)	6480464	bisphenol A results in decreased expression of C21ORF58 mRNA	CTD	PMID:27685785 and PMID:36232920
C20h21orf58	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of C20H21ORF58 mRNA	CTD	PMID:36041667
C20h21orf58	Rat	butan-1-ol	multiple interactions	ISO	C21orf58 (Homo sapiens)	6480464	[[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of C21ORF58 mRNA	CTD	PMID:29432896
C20h21orf58	Rat	cadmium dichloride	decreases methylation	EXP		6480464	Cadmium Chloride results in decreased methylation of C20H21ORF58 promoter	CTD	PMID:22457795
C20h21orf58	Rat	calcitriol	decreases expression	ISO	C21orf58 (Homo sapiens)	6480464	Calcitriol results in decreased expression of C21ORF58 mRNA	CTD	PMID:21592394
C20h21orf58	Rat	calcitriol	multiple interactions	ISO	C21orf58 (Homo sapiens)	6480464	[Testosterone co-treated with Calcitriol] results in decreased expression of C21ORF58 mRNA	CTD	PMID:21592394
C20h21orf58	Rat	cannabidiol	decreases expression	ISO	C21orf58 (Homo sapiens)	6480464	Cannabidiol results in decreased expression of C21ORF58 mRNA	CTD	PMID:33244087
C20h21orf58	Rat	chromium(6+)	multiple interactions	ISO	C21orf58 (Homo sapiens)	6480464	[zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of C21ORF58 mRNA	CTD	PMID:38479592
C20h21orf58	Rat	clothianidin	decreases expression	ISO	C21orf58 (Homo sapiens)	6480464	clothianidin results in decreased expression of C21ORF58 mRNA	CTD	PMID:31626844
C20h21orf58	Rat	copper atom	multiple interactions	ISO	C21orf58 (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in decreased expression of C21ORF58 mRNA	CTD	PMID:20971185
C20h21orf58	Rat	copper(0)	multiple interactions	ISO	C21orf58 (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in decreased expression of C21ORF58 mRNA	CTD	PMID:20971185
C20h21orf58	Rat	crocidolite asbestos	decreases expression	ISO	C21orf58 (Homo sapiens)	6480464	Asbestos and Crocidolite results in decreased expression of C21ORF58 mRNA	CTD	PMID:29523930
C20h21orf58	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of C20H21ORF58 mRNA	CTD	PMID:26577399
C20h21orf58	Rat	Dibutyl phosphate	affects expression	ISO	C21orf58 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of C21ORF58 mRNA	CTD	PMID:37042841
C20h21orf58	Rat	dicrotophos	increases expression	ISO	C21orf58 (Homo sapiens)	6480464	dicrotophos results in increased expression of C21ORF58 mRNA	CTD	PMID:28302478
C20h21orf58	Rat	dorsomorphin	multiple interactions	ISO	C21orf58 (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
C20h21orf58	Rat	entinostat	multiple interactions	ISO	C21orf58 (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of C21ORF58 mRNA	CTD	PMID:27188386
C20h21orf58	Rat	entinostat	affects expression	ISO	C21orf58 (Homo sapiens)	6480464	entinostat affects the expression of C21ORF58 mRNA	CTD	PMID:26272509
C20h21orf58	Rat	ethyl methanesulfonate	increases expression	ISO	C21orf58 (Homo sapiens)	6480464	Ethyl Methanesulfonate results in increased expression of C21ORF58 mRNA	CTD	PMID:23649840
C20h21orf58	Rat	gallic acid	decreases expression	ISO	C21orf58 (Homo sapiens)	6480464	Gallic Acid results in decreased expression of C21ORF58 mRNA	CTD	PMID:34408198
C20h21orf58	Rat	leflunomide	decreases expression	ISO	C21orf58 (Homo sapiens)	6480464	leflunomide results in decreased expression of C21ORF58 mRNA	CTD	PMID:28988120
C20h21orf58	Rat	methyl methanesulfonate	increases expression	ISO	C21orf58 (Homo sapiens)	6480464	Methyl Methanesulfonate results in increased expression of C21ORF58 mRNA	CTD	PMID:23649840
C20h21orf58	Rat	N-Nitrosopyrrolidine	decreases expression	ISO	C21orf58 (Homo sapiens)	6480464	N-Nitrosopyrrolidine results in decreased expression of C21ORF58 mRNA	CTD	PMID:32234424
C20h21orf58	Rat	paracetamol	increases expression	ISO	C21orf58 (Homo sapiens)	6480464	Acetaminophen results in increased expression of C21ORF58 mRNA	CTD	PMID:22230336
C20h21orf58	Rat	paracetamol	decreases expression	ISO	C21orf58 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of C21ORF58 mRNA	CTD	PMID:29067470
C20h21orf58	Rat	SB 431542	multiple interactions	ISO	C21orf58 (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
C20h21orf58	Rat	sodium arsenite	decreases expression	ISO	C21orf58 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of C21ORF58 mRNA	CTD	PMID:38568856
C20h21orf58	Rat	sodium arsenite	affects expression	ISO	C21orf58 (Homo sapiens)	6480464	sodium arsenite affects the expression of C21ORF58 mRNA	CTD	PMID:34032870
C20h21orf58	Rat	sunitinib	decreases expression	ISO	C21orf58 (Homo sapiens)	6480464	Sunitinib results in decreased expression of C21ORF58 mRNA	CTD	PMID:31533062
C20h21orf58	Rat	testosterone	multiple interactions	ISO	C21orf58 (Homo sapiens)	6480464	[Testosterone co-treated with Calcitriol] results in decreased expression of C21ORF58 mRNA	CTD	PMID:21592394
C20h21orf58	Rat	testosterone	decreases expression	ISO	C21orf58 (Homo sapiens)	6480464	Testosterone results in decreased expression of C21ORF58 mRNA	CTD	PMID:21592394
C20h21orf58	Rat	thiram	decreases expression	ISO	C21orf58 (Homo sapiens)	6480464	Thiram results in decreased expression of C21ORF58 mRNA	CTD	PMID:38568856
C20h21orf58	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of C20H21ORF58 mRNA	CTD	PMID:33387578
C20h21orf58	Rat	urethane	decreases expression	ISO	C21orf58 (Homo sapiens)	6480464	Urethane results in decreased expression of C21ORF58 mRNA	CTD	PMID:28818685
C20h21orf58	Rat	valproic acid	increases methylation	ISO	C21orf58 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of C21ORF58 gene	CTD	PMID:29154799
C20h21orf58	Rat	valproic acid	decreases expression	ISO	C21orf58 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of C21ORF58 mRNA	CTD	PMID:26272509
C20h21orf58	Rat	valproic acid	multiple interactions	ISO	C21orf58 (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of C21ORF58 mRNA	CTD	PMID:27188386

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
C20h21orf58	Rat	protein binding	enables	ISO	C21orf58 (Homo sapiens)	1624291	UniProtKB:O15160 more ...	RGD	PMID:25416956 and PMID:32296183

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932

C20h21orf58
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	12,165,853 - 12,187,271 (-)	NCBI		GRCr8
mRatBN7.2	20	12,167,279 - 12,188,665 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	12,175,442 - 12,187,017 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	12,870,964 - 12,882,529 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	12,231,887 - 12,243,458 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	12,703,666 - 12,715,231 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	12,927,310 - 12,938,891 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	12,927,320 - 12,938,891 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	15,085,285 - 15,096,866 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	12,591,067 - 12,602,648 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	20	13,673,278 - 13,684,859 (-)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

C21orf58
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	21	46,300,430 - 46,323,870 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	21	46,300,181 - 46,323,875 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	21	47,720,344 - 47,743,784 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	21	46,545,475 - 46,568,213 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	21	46,545,474 - 46,568,213	NCBI
Celera	21	32,834,819 - 32,857,559 (-)	NCBI		Celera
Cytogenetic Map	21	q22.3	NCBI
HuRef	21	33,104,411 - 33,126,619 (-)	NCBI		HuRef
CHM1_1	21	47,281,792 - 47,304,522 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	21	44,685,809 - 44,709,216 (-)	NCBI		T2T-CHM13v2.0

2610028H24Rik
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	76,284,883 - 76,297,052 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	76,284,915 - 76,296,944 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	76,449,049 - 76,461,218 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	76,449,081 - 76,461,110 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	75,911,826 - 75,923,963 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	75,892,860 - 75,904,821 (+)	NCBI		MGSCv36	mm8
Celera	10	77,493,470 - 77,505,607 (+)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	38.84	NCBI

CUNH21orf58
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955407	42,712,152 - 42,728,690 (-)	NCBI	ChiLan1.0	ChiLan1.0

C22H21orf58
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	22	42,397,567 - 42,421,611 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	21	37,270,598 - 37,295,168 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	21	32,641,582 - 32,665,117 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	21	45,892,145 - 45,914,445 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	21	45,892,145 - 45,914,445 (-)	Ensembl	panpan1.1		panPan2

C31H21orf58
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	31	39,567,515 - 39,576,238 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	31	39,567,614 - 39,574,285 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	31	38,793,270 - 38,804,879 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	31	39,206,700 - 39,218,311 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	31	39,068,308 - 39,079,918 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	31	39,031,474 - 39,037,639 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	31	39,547,127 - 39,558,737 (-)	NCBI		UU_Cfam_GSD_1.0

CUNH21orf58
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404971	38,866,114 - 38,877,736 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936778	252,866 - 264,677 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CUNH21orf58
(Sus scrofa - pig)

No map positions available.

CUNH21orf58
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	89,916,904 - 89,934,889 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666054	18,304,431 - 18,328,329 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

CUNH21orf58
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624745	31,383,509 - 31,399,877 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in C20h21orf58
153 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	87
Count of miRNA genes:	71
Interacting mature miRNAs:	79
Transcripts:	ENSRNOT00000017141
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4889870	Pur30	Proteinuria QTL 30	19	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	8042410	29322208	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
4889857	Pur27	Proteinuria QTL 27	12.2	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	4606607	17617956	Rat
70154	Insul2	Insulin level QTL 2	3.75		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	6691706	17489458	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
1581577	Pur15	Proteinuria QTL 15	4.38	0.0002	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	20	8042410	17617956	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
9590092	Insglur9	Insulin/glucose ratio QTL 9	18.38	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	20	11757515	54435887	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	2892597	26381954	Rat
7387283	Uae44	Urinary albumin excretion QTL 44		0.1712	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	20	1	26123605	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	4606607	17617956	Rat
631265	Iresp1	Immunoglobin response QTL1	8.3		blood anti-double stranded DNA antibody amount (VT:0004762)	serum anti-DNA antibody level (CMO:0001533)	20	9039719	13461775	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
7411652	Foco24	Food consumption QTL 24		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	11757515	54435887	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	3621656	14101050	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	97	63	62	31	25	31	6	188	97	77	43	58	31


RefSeq Transcripts	NM_001079708	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039099005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039099006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039099008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063279460	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC098763	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC128753	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000017141 ⟹ ENSRNOP00000017141

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	12,175,442 - 12,187,017 (-)	Ensembl
Rnor_6.0 Ensembl	20	12,927,320 - 12,938,891 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095238 ⟹ ENSRNOP00000091635

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	12,175,442 - 12,186,838 (-)	Ensembl

RefSeq Acc Id:

NM_001079708 ⟹ NP_001073176

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	12,174,922 - 12,186,503 (-)	NCBI
mRatBN7.2	20	12,175,436 - 12,187,017 (-)	NCBI
Rnor_6.0	20	12,927,310 - 12,938,891 (-)	NCBI
Rnor_5.0	20	15,085,285 - 15,096,866 (-)	NCBI
RGSC_v3.4	20	12,591,067 - 12,602,648 (-)	RGD
Celera	20	13,673,278 - 13,684,859 (-)	RGD

Sequence:

show sequence

CAGACTCCAGGGAAGGCTCTGGCATTGTGGTCTAGAGAGGGATCTGACAATCTCCCATTTACATGTCTTGAGGCACCATGACCCCTAAGAGGGCTCTTTGCTGCACATAACTAAGGACCAGGGCAGAG
TGAGGACTCTAGTCTCCTACTTCTCTGCAGGCTCCTTTTCAGTCAGTAGTCATGACGTTGGACTCCTCAATGGCGGATCAGATGACCCGGCTGAGGTTAAGACTCCTGGAACAGATGCTGGAGCAGGA
ACGAGAGAGCATGGACAGAGCAGGACAACAGGAAAAGCCAGACCCTGCCCTCCAGAGTGCTTTGATGAGAAGGAAGGACCTTCTACAGAGGCTCTGGGAGCAGCAGCTGATGGACGAACACTCCCCGA
CCTGGAGGACACATGGAAAAGCCATAGCGCCAACCCTGAACCCAGAGGTCCCTCCCATGGATGTCTTCCCTGCTGCCTCCCCATCTTTGCCCCAACCCCCAGAGCCACTAAGGATCATCCAGCAACCG
GTCCCCCAGTCTCCTGCAACCATAATACAGCAGTTACCCCAGCAGCCACTGATCGCACAGATTCCTCCTCCTCAGGCCTTTCCCGCTCAAAGATCAGGAAGTATTAAGGAAGACATGGTGGAGATGAT
GTTGATGCAGAACGCACAGATGCACCAGATCCTCATGCAGAACATGATGCTTAAAGCCCTGCCCCCTGGGCCCACGGGGCCACGTGCTACTACCCTGCAGGACCAACGATGGGTGCACCACGGGGTCC
CGAGAGCTGAAAAGCAGAAGCCATCTCCGGTTCACCACCACCACCACTATGCGCCCACCACCCAGCTGCAGGCCGCCTCCGCAGCTGGCGCCCCTTCCGGTTATGCCGGGTGGCCTCCAGTGGTTGCA
GCCACTGCGCTCCCACATGCAGCCAGCTTCTTGCCCACTGTGAGCCACCTGACCGAGCCATCGACCTCCCATCCTAGCTACCCTTAGCACGCCCAGTGTGGAGGGAGAAAGCTAGTGTCTTGCTGCAG
GTAAGCCCCAGTCGCCAGGCCACGTGTCTCTGTCCCCCTCTGGAACAGTTATGTGTTAGGTTTTCTGAGAGCCCAGCAGGGTTGGTCTCATAGGCTGTCCGTCCCCAAGAGCTGAGCTGCACTGAAAA
ATACGTGCTGCTTTTCCGGGTGTGTCAGACCATTCCCGGATCTCAGCAAGCATCCTAGCATTGCTTGTCAACCTCCACTACTCTCCTGGGCCCTCTGGGAACCCTAGGGGAATGAATGCCTCACCCAG
GCGGAATACAAACATTTTATTATGAAAGACTAAAGACGGGCTGTAGAGATGGCTCAGCGGTTGAGAGCGCTGACTGCTCTTCCAGAGGCCCTGAGTTCAAGTCCCGGCAACTACATGGTGGCTCACAG
CCATCTGTGGTGGGATCCAATGTCCTCTTCTGGTGTGTCTGAAGATAGCTACAGTGTACTCATATAATAAATAAATAAATCTTTAAGACTAAAGACAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039099005 ⟹ XP_038954933

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	12,165,853 - 12,186,577 (-)	NCBI
mRatBN7.2	20	12,167,279 - 12,187,092 (-)	NCBI

RefSeq Acc Id:

XM_039099006 ⟹ XP_038954934

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	12,172,158 - 12,186,577 (-)	NCBI
mRatBN7.2	20	12,173,293 - 12,187,092 (-)	NCBI

RefSeq Acc Id:

XM_039099008 ⟹ XP_038954936

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	12,174,922 - 12,187,271 (-)	NCBI
mRatBN7.2	20	12,175,809 - 12,187,716 (-)	NCBI

RefSeq Acc Id:

XM_063279460 ⟹ XP_063135530

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	12,172,158 - 12,186,577 (-)	NCBI


Protein RefSeqs	NP_001073176	(Get FASTA)	NCBI Sequence Viewer
	XP_038954933	(Get FASTA)	NCBI Sequence Viewer
	XP_038954934	(Get FASTA)	NCBI Sequence Viewer
	XP_038954936	(Get FASTA)	NCBI Sequence Viewer
	XP_063135530	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI28754	(Get FASTA)	NCBI Sequence Viewer
	EDL97148	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000017141
	ENSRNOP00000017141.4
	ENSRNOP00000091635.1

RefSeq Acc Id:

NP_001073176 ⟸ NM_001079708

- UniProtKB:

A1A5P8 (UniProtKB/TrEMBL), A6JKD2 (UniProtKB/TrEMBL), A0A8I6AGI1 (UniProtKB/TrEMBL), F7ESR2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTLDSSMADQMTRLRLRLLEQMLEQERESMDRAGQQEKPDPALQSALMRRKDLLQRLWEQQLMDEHSPTWRTHGKAIAPTLNPEVPPMDVFPAASPSLPQPPEPLRIIQQPVPQSPATIIQQLPQQPL
IAQIPPPQAFPAQRSGSIKEDMVEMMLMQNAQMHQILMQNMMLKALPPGPTGPRATTLQDQRWVHHGVPRAEKQKPSPVHHHHHYAPTTQLQAASAAGAPSGYAGWPPVVAATALPHAASFLPTVSHL
TEPSTSHPSYP

hide sequence

Ensembl Acc Id:

ENSRNOP00000017141 ⟸ ENSRNOT00000017141

RefSeq Acc Id:	XP_038954933 ⟸ XM_039099005
- Peptide Label:	isoform X1
- UniProtKB:	A1A5P8 (UniProtKB/TrEMBL), A6JKD2 (UniProtKB/TrEMBL), A0A8I6AGI1 (UniProtKB/TrEMBL), F7ESR2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038954934 ⟸ XM_039099006
- Peptide Label:	isoform X1
- UniProtKB:	A1A5P8 (UniProtKB/TrEMBL), A6JKD2 (UniProtKB/TrEMBL), A0A8I6AGI1 (UniProtKB/TrEMBL), F7ESR2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038954936 ⟸ XM_039099008
- Peptide Label:	isoform X1
- UniProtKB:	A1A5P8 (UniProtKB/TrEMBL), A6JKD2 (UniProtKB/TrEMBL), A0A8I6AGI1 (UniProtKB/TrEMBL), F7ESR2 (UniProtKB/TrEMBL)

Protein Domains

DUF4587

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A1A5P8-F1-model_v2	AlphaFold	A1A5P8	1-267	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-4188	BioCyc
Ensembl Genes	ENSRNOG00000012714	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000017141	ENTREZGENE
	ENSRNOT00000017141.6	UniProtKB/TrEMBL
	ENSRNOT00000095238.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7100076	IMAGE-MGC_LOAD
InterPro	DUF4587	UniProtKB/TrEMBL
	PRR29-like	UniProtKB/TrEMBL
KEGG Report	rno:499419	UniProtKB/TrEMBL
MGC_CLONE	MGC:156707	IMAGE-MGC_LOAD
NCBI Gene	499419	ENTREZGENE
PANTHER	PTHR28604	UniProtKB/TrEMBL
	RIKEN CDNA 2610028H24 GENE	UniProtKB/TrEMBL
Pfam	DUF4587	UniProtKB/TrEMBL
PhenoGen	C20h21orf58	PhenoGen
RatGTEx	ENSRNOG00000012714	RatGTEx
UniProt	A0A8I6AGI1	ENTREZGENE, UniProtKB/TrEMBL
	A1A5P8	ENTREZGENE
	A6JKD2	ENTREZGENE, UniProtKB/TrEMBL
	F7ESR2	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	A1A5P8	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2023-09-19	C20h21orf58	similar to human chromosome 21 open reading frame 58	RGD1564149	similar to Protein C21orf58	Symbol and Name Changed	1299863	APPROVED
2008-04-30	RGD1564149	similar to Protein C21orf58	RGD1564149_predicted	similar to Protein C21orf58 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1564149_predicted	similar to Protein C21orf58 (predicted)	LOC499419	similar to Protein C21orf58	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC499419	similar to Protein C21orf58			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar