Symbol:
Tigar
Name:
TP53 induced glycolysis regulatory phosphatase
RGD ID:
1560038
Description:
Predicted to enable fructose-2,6-bisphosphate 2-phosphatase activity. Predicted to be involved in several processes, including cellular response to cobalt ion; regulation of phosphate metabolic process; and response to ischemia. Predicted to act upstream of or within several processes, including fructose 2,6-bisphosphate metabolic process; negative regulation of metabolic process; and positive regulation of cardiac muscle cell apoptotic process. Predicted to be located in mitochondrial outer membrane and nucleus. Predicted to be active in cytosol. Orthologous to human TIGAR (TP53 induced glycolysis regulatory phosphatase); INTERACTS WITH 17beta-estradiol; 6-propyl-2-thiouracil; acetamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
fructose-2,6-bisphosphatase TIGAR; hypothetical protein LOC502894; LOC502894; TP53-induced glycolysis and apoptosis regulator; uncharacterized protein LOC502894
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Related Pseudogenes:
Tigar-ps1
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 161,613,306 - 161,632,248 (-) NCBI GRCr8 mRatBN7.2 4 159,927,136 - 159,946,077 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 87,509,809 - 87,510,466 (+) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 4 159,927,139 - 159,946,029 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 166,156,946 - 166,175,860 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 161,939,848 - 161,958,766 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 160,573,896 - 160,592,815 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 159,635,145 - 159,654,108 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 159,635,153 - 159,654,063 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 231,948,786 - 231,966,869 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 163,481,393 - 163,502,412 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 4 148,642,195 - 148,661,115 (-) NCBI Celera Cytogenetic Map 4 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tigar Rat (-)-demecolcine increases expression ISO TIGAR (Homo sapiens) 6480464 Demecolcine results in increased expression of TIGAR mRNA CTD PMID:23649840 Tigar Rat (S)-colchicine decreases expression ISO TIGAR (Homo sapiens) 6480464 Colchicine results in decreased expression of TIGAR mRNA CTD PMID:24211769 Tigar Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Tigar (Mus musculus) 6480464 NADP inhibits the reaction [TIGAR protein affects the reaction [1-Methyl-4-phenyl-1 more ... CTD PMID:33359019 Tigar Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine increases expression ISO Tigar (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:33359019 Tigar Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of TIGAR mRNA CTD PMID:32145629 Tigar Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO TIGAR (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Tigar Rat 2,4,6-tribromophenol increases expression ISO TIGAR (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Tigar Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO TIGAR (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of TIGAR protein CTD PMID:31675489 Tigar Rat 4,4'-sulfonyldiphenol increases expression ISO Tigar (Mus musculus) 6480464 bisphenol S results in increased expression of TIGAR mRNA CTD PMID:39298647 Tigar Rat 5-fluorouracil multiple interactions ISO TIGAR (Homo sapiens) 6480464 TP53 protein affects the reaction [Fluorouracil results in increased expression of TIGAR mRNA] CTD PMID:15016801 Tigar Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of TIGAR mRNA CTD PMID:25825206 Tigar Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of TIGAR mRNA CTD PMID:31881176 Tigar Rat actinomycin D multiple interactions ISO TIGAR (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of TIGAR protein CTD PMID:38460933 Tigar Rat adefovir pivoxil increases expression ISO TIGAR (Homo sapiens) 6480464 adefovir dipivoxil results in increased expression of TIGAR mRNA CTD PMID:25596134 Tigar Rat adenine decreases expression ISO TIGAR (Homo sapiens) 6480464 Adenine results in decreased expression of TIGAR mRNA CTD PMID:24211769 Tigar Rat aflatoxin B1 affects expression ISO TIGAR (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of TIGAR protein CTD PMID:20106945 Tigar Rat aflatoxin B1 increases expression ISO TIGAR (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of TIGAR mRNA CTD PMID:21632981 more ... Tigar Rat antirheumatic drug decreases expression ISO TIGAR (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of TIGAR mRNA CTD PMID:24449571 Tigar Rat aristolochic acid A increases expression ISO TIGAR (Homo sapiens) 6480464 aristolochic acid I results in increased expression of TIGAR protein CTD PMID:33212167 Tigar Rat arsane multiple interactions ISO TIGAR (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TIGAR mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of TIGAR mRNA CTD PMID:39836092 Tigar Rat arsenic atom multiple interactions ISO TIGAR (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TIGAR mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of TIGAR mRNA CTD PMID:39836092 Tigar Rat arsenite(3-) multiple interactions ISO TIGAR (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to TIGAR mRNA] CTD PMID:32406909 Tigar Rat arsenous acid multiple interactions ISO TIGAR (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to TIGAR protein] CTD PMID:26598702 Tigar Rat benzo[a]pyrene decreases expression ISO Tigar (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of TIGAR mRNA CTD PMID:27195522 Tigar Rat benzo[a]pyrene increases expression ISO TIGAR (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of TIGAR mRNA CTD PMID:20106945 more ... Tigar Rat benzo[a]pyrene diol epoxide I increases expression ISO TIGAR (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Tigar Rat bisphenol A decreases expression ISO Tigar (Mus musculus) 6480464 bisphenol A results in decreased expression of TIGAR mRNA CTD PMID:26063408 Tigar Rat bisphenol A increases expression ISO TIGAR (Homo sapiens) 6480464 bisphenol A results in increased expression of TIGAR protein CTD PMID:34186270 Tigar Rat bisphenol A decreases expression ISO TIGAR (Homo sapiens) 6480464 bisphenol A results in decreased expression of TIGAR protein CTD PMID:31675489 Tigar Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of TIGAR mRNA CTD PMID:25181051 Tigar Rat Bisphenol B increases expression ISO TIGAR (Homo sapiens) 6480464 bisphenol B results in increased expression of TIGAR protein CTD PMID:34186270 Tigar Rat bisphenol F increases expression ISO TIGAR (Homo sapiens) 6480464 bisphenol F results in increased expression of TIGAR protein CTD PMID:34186270 Tigar Rat cadmium atom multiple interactions ISO TIGAR (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TIGAR mRNA CTD PMID:35301059 Tigar Rat cadmium dichloride increases expression ISO TIGAR (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of TIGAR mRNA CTD PMID:25596134 Tigar Rat cadmium dichloride multiple interactions ISO TIGAR (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TIGAR mRNA CTD PMID:35301059 Tigar Rat cantharidin decreases expression ISO Tigar (Mus musculus) 6480464 Cantharidin results in decreased expression of TIGAR mRNA CTD PMID:36907384 Tigar Rat captan increases expression ISO Tigar (Mus musculus) 6480464 Captan results in increased expression of TIGAR mRNA CTD PMID:31558096 Tigar Rat carbamazepine affects expression ISO TIGAR (Homo sapiens) 6480464 Carbamazepine affects the expression of TIGAR mRNA CTD PMID:25979313 Tigar Rat chloroacetaldehyde increases expression ISO TIGAR (Homo sapiens) 6480464 chloroacetaldehyde results in increased expression of TIGAR mRNA CTD PMID:25596134 Tigar Rat chlorpyrifos decreases expression ISO Tigar (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of TIGAR mRNA CTD PMID:37019170 Tigar Rat cidofovir anhydrous increases expression ISO TIGAR (Homo sapiens) 6480464 Cidofovir results in increased expression of TIGAR mRNA CTD PMID:25596134 Tigar Rat cisplatin increases expression ISO TIGAR (Homo sapiens) 6480464 Cisplatin results in increased expression of TIGAR mRNA CTD PMID:21532991 more ... Tigar Rat clodronic acid increases expression ISO TIGAR (Homo sapiens) 6480464 Clodronic Acid results in increased expression of TIGAR mRNA CTD PMID:25596134 Tigar Rat copper(II) sulfate increases expression ISO TIGAR (Homo sapiens) 6480464 Copper Sulfate results in increased expression of TIGAR mRNA CTD PMID:19549813 Tigar Rat coumestrol multiple interactions ISO TIGAR (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of TIGAR mRNA CTD PMID:19167446 Tigar Rat cyclosporin A increases expression ISO TIGAR (Homo sapiens) 6480464 Cyclosporine results in increased expression of TIGAR mRNA CTD PMID:20106945 more ... Tigar Rat cyclosporin A decreases expression ISO TIGAR (Homo sapiens) 6480464 Cyclosporine results in decreased expression of TIGAR mRNA CTD PMID:27989131 Tigar Rat decabromodiphenyl ether increases expression ISO TIGAR (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of TIGAR protein CTD PMID:31675489 Tigar Rat diarsenic trioxide multiple interactions ISO TIGAR (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to TIGAR protein] CTD PMID:26598702 Tigar Rat dicrotophos decreases expression ISO TIGAR (Homo sapiens) 6480464 dicrotophos results in decreased expression of TIGAR mRNA CTD PMID:28302478 Tigar Rat dimethylarsinous acid increases expression ISO TIGAR (Homo sapiens) 6480464 dimethylarsinous acid results in increased expression of TIGAR mRNA CTD PMID:20886546 Tigar Rat dioxygen decreases expression ISO TIGAR (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of TIGAR mRNA CTD PMID:25596134 Tigar Rat dorsomorphin multiple interactions ISO TIGAR (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TIGAR mRNA CTD PMID:27188386 Tigar Rat doxorubicin increases expression ISO TIGAR (Homo sapiens) 6480464 Doxorubicin results in increased expression of TIGAR mRNA CTD PMID:29803840 Tigar Rat doxorubicin affects expression ISO TIGAR (Homo sapiens) 6480464 Doxorubicin affects the expression of TIGAR mRNA CTD PMID:38447685 Tigar Rat Enterolactone multiple interactions ISO TIGAR (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of TIGAR mRNA CTD PMID:19167446 Tigar Rat enzyme inhibitor multiple interactions ISO TIGAR (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of TIGAR protein CTD PMID:23301498 Tigar Rat epoxiconazole increases expression ISO Tigar (Mus musculus) 6480464 epoxiconazole results in increased expression of TIGAR mRNA CTD PMID:35436446 Tigar Rat ethyl methanesulfonate increases expression ISO TIGAR (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of TIGAR mRNA CTD PMID:23649840 Tigar Rat folpet increases expression ISO Tigar (Mus musculus) 6480464 folpet results in increased expression of TIGAR mRNA CTD PMID:31558096 Tigar Rat formaldehyde increases expression ISO TIGAR (Homo sapiens) 6480464 Formaldehyde results in increased expression of TIGAR mRNA CTD PMID:23649840 Tigar Rat FR900359 decreases phosphorylation ISO TIGAR (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of TIGAR protein CTD PMID:37730182 Tigar Rat hydrogen peroxide affects expression ISO TIGAR (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of TIGAR mRNA CTD PMID:20044591 Tigar Rat ifosfamide increases expression ISO TIGAR (Homo sapiens) 6480464 Ifosfamide results in increased expression of TIGAR mRNA CTD PMID:25596134 Tigar Rat ivermectin decreases expression ISO TIGAR (Homo sapiens) 6480464 Ivermectin results in decreased expression of TIGAR protein CTD PMID:32959892 Tigar Rat kainic acid multiple interactions EXP 6480464 NADP inhibits the reaction [Kainic Acid results in decreased expression of TIGAR protein] CTD PMID:32057834 Tigar Rat kainic acid decreases expression EXP 6480464 Kainic Acid results in decreased expression of TIGAR protein CTD PMID:32057834 Tigar Rat manganese atom multiple interactions ISO TIGAR (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TIGAR mRNA CTD PMID:39836092 Tigar Rat manganese(0) multiple interactions ISO TIGAR (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TIGAR mRNA CTD PMID:39836092 Tigar Rat manganese(II) chloride multiple interactions ISO TIGAR (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TIGAR mRNA CTD PMID:39836092 Tigar Rat methamphetamine increases expression ISO Tigar (Mus musculus) 6480464 Methamphetamine results in increased expression of TIGAR mRNA CTD PMID:36914120 Tigar Rat methotrexate increases expression ISO TIGAR (Homo sapiens) 6480464 Methotrexate results in increased expression of TIGAR mRNA CTD PMID:21678067 Tigar Rat methoxyacetic acid multiple interactions ISO TIGAR (Homo sapiens) 6480464 [Promegestone co-treated with methoxyacetic acid] results in increased expression of TIGAR mRNA CTD PMID:15103026 Tigar Rat methyl methanesulfonate increases expression ISO TIGAR (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of TIGAR mRNA CTD PMID:23649840 Tigar Rat N-methyl-4-phenylpyridinium multiple interactions EXP 6480464 SP1 protein affects the reaction [1-Methyl-4-phenylpyridinium results in increased expression of TIGAR protein] CTD PMID:33359019 Tigar Rat N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of TIGAR mRNA and 1-Methyl-4-phenylpyridinium results in increased expression of TIGAR protein CTD PMID:33359019 Tigar Rat NADP zwitterion increases abundance EXP 6480464 TIGAR protein results in increased abundance of NADP CTD PMID:33359019 Tigar Rat NADP zwitterion multiple interactions EXP 6480464 NADP inhibits the reaction [Kainic Acid results in decreased expression of TIGAR protein] CTD PMID:32057834 Tigar Rat NADP zwitterion multiple interactions ISO Tigar (Mus musculus) 6480464 NADP inhibits the reaction [TIGAR protein affects the reaction [1-Methyl-4-phenyl-1 more ... CTD PMID:33359019 Tigar Rat NADP zwitterion increases abundance ISO Tigar (Mus musculus) 6480464 TIGAR protein results in increased abundance of NADP CTD PMID:33359019 Tigar Rat NADP(+) multiple interactions ISO Tigar (Mus musculus) 6480464 NADP inhibits the reaction [TIGAR protein affects the reaction [1-Methyl-4-phenyl-1 more ... CTD PMID:33359019 Tigar Rat NADP(+) multiple interactions EXP 6480464 NADP inhibits the reaction [Kainic Acid results in decreased expression of TIGAR protein] CTD PMID:32057834 Tigar Rat NADP(+) increases abundance EXP 6480464 TIGAR protein results in increased abundance of NADP CTD PMID:33359019 Tigar Rat NADP(+) increases abundance ISO Tigar (Mus musculus) 6480464 TIGAR protein results in increased abundance of NADP CTD PMID:33359019 Tigar Rat nickel atom increases expression ISO TIGAR (Homo sapiens) 6480464 Nickel results in increased expression of TIGAR mRNA CTD PMID:24768652 and PMID:25583101 Tigar Rat niclosamide decreases expression ISO TIGAR (Homo sapiens) 6480464 Niclosamide results in decreased expression of TIGAR mRNA CTD PMID:36318118 Tigar Rat Nutlin-3 multiple interactions ISO TIGAR (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of TIGAR protein CTD PMID:38460933 Tigar Rat okadaic acid increases expression ISO TIGAR (Homo sapiens) 6480464 Okadaic Acid results in increased expression of TIGAR mRNA CTD PMID:38832940 Tigar Rat paracetamol increases expression ISO TIGAR (Homo sapiens) 6480464 Acetaminophen results in increased expression of TIGAR mRNA CTD PMID:22230336 Tigar Rat phenylmercury acetate increases expression ISO TIGAR (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of TIGAR mRNA CTD PMID:26272509 Tigar Rat phenylmercury acetate multiple interactions ISO TIGAR (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TIGAR mRNA CTD PMID:27188386 Tigar Rat potassium bromate increases expression ISO TIGAR (Homo sapiens) 6480464 potassium bromate results in increased expression of TIGAR mRNA CTD PMID:30559759 Tigar Rat progesterone decreases expression ISO TIGAR (Homo sapiens) 6480464 Progesterone results in decreased expression of TIGAR mRNA CTD PMID:18037150 Tigar Rat promegestone multiple interactions ISO TIGAR (Homo sapiens) 6480464 [Promegestone co-treated with methoxyacetic acid] results in increased expression of TIGAR mRNA CTD PMID:15103026 Tigar Rat propanal increases expression ISO TIGAR (Homo sapiens) 6480464 propionaldehyde results in increased expression of TIGAR mRNA CTD PMID:26079696 Tigar Rat quercetin increases expression ISO TIGAR (Homo sapiens) 6480464 Quercetin results in increased expression of TIGAR mRNA CTD PMID:21632981 Tigar Rat reactive oxygen species increases expression ISO TIGAR (Homo sapiens) 6480464 Reactive Oxygen Species results in increased expression of TIGAR mRNA CTD PMID:21042727 Tigar Rat reactive oxygen species multiple interactions ISO TIGAR (Homo sapiens) 6480464 TP53 protein promotes the reaction [Reactive Oxygen Species results in increased expression of TIGAR mRNA] CTD PMID:21042727 Tigar Rat resveratrol increases expression ISO Tigar (Mus musculus) 6480464 resveratrol results in increased expression of TIGAR protein CTD PMID:25505154 Tigar Rat resveratrol multiple interactions ISO TIGAR (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of TIGAR mRNA CTD PMID:23557933 Tigar Rat rotenone decreases expression ISO TIGAR (Homo sapiens) 6480464 Rotenone results in decreased expression of TIGAR mRNA CTD PMID:29955902 and PMID:33512557 Tigar Rat SB 431542 multiple interactions ISO TIGAR (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TIGAR mRNA CTD PMID:27188386 Tigar Rat sodium arsenite decreases expression ISO TIGAR (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TIGAR mRNA CTD PMID:34032870 Tigar Rat sodium arsenite multiple interactions ISO TIGAR (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TIGAR mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of TIGAR mRNA CTD PMID:39836092 Tigar Rat tamoxifen decreases response to substance ISO TIGAR (Homo sapiens) 6480464 TIGAR protein results in decreased susceptibility to Tamoxifen CTD PMID:22041887 Tigar Rat tamoxifen increases expression ISO TIGAR (Homo sapiens) 6480464 Tamoxifen results in increased expression of TIGAR mRNA CTD PMID:22041887 Tigar Rat testosterone decreases expression ISO TIGAR (Homo sapiens) 6480464 Testosterone results in decreased expression of TIGAR mRNA CTD PMID:33359661 Tigar Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of TIGAR mRNA CTD PMID:31618665 Tigar Rat tunicamycin increases expression ISO TIGAR (Homo sapiens) 6480464 Tunicamycin results in increased expression of TIGAR mRNA CTD PMID:22378314 Tigar Rat tunicamycin decreases expression ISO TIGAR (Homo sapiens) 6480464 Tunicamycin results in decreased expression of TIGAR mRNA CTD PMID:29453283 Tigar Rat valproic acid increases expression ISO TIGAR (Homo sapiens) 6480464 Valproic Acid results in increased expression of TIGAR mRNA CTD PMID:23179753 Tigar Rat valproic acid affects expression ISO TIGAR (Homo sapiens) 6480464 Valproic Acid affects the expression of TIGAR mRNA CTD PMID:25979313 Tigar Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of TIGAR mRNA CTD PMID:22615374 Tigar Rat vincristine increases expression ISO TIGAR (Homo sapiens) 6480464 Vincristine results in increased expression of TIGAR mRNA CTD PMID:23649840 Tigar Rat zoledronic acid decreases expression ISO TIGAR (Homo sapiens) 6480464 zoledronic acid results in decreased expression of TIGAR mRNA CTD PMID:25596134
(-)-demecolcine (ISO) (S)-colchicine (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17beta-estradiol (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,4,6-tribromophenol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) actinomycin D (ISO) adefovir pivoxil (ISO) adenine (ISO) aflatoxin B1 (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (ISO) cantharidin (ISO) captan (ISO) carbamazepine (ISO) chloroacetaldehyde (ISO) chlorpyrifos (ISO) cidofovir anhydrous (ISO) cisplatin (ISO) clodronic acid (ISO) copper(II) sulfate (ISO) coumestrol (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) diarsenic trioxide (ISO) dicrotophos (ISO) dimethylarsinous acid (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) Enterolactone (ISO) enzyme inhibitor (ISO) epoxiconazole (ISO) ethyl methanesulfonate (ISO) folpet (ISO) formaldehyde (ISO) FR900359 (ISO) hydrogen peroxide (ISO) ifosfamide (ISO) ivermectin (ISO) kainic acid (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methamphetamine (ISO) methotrexate (ISO) methoxyacetic acid (ISO) methyl methanesulfonate (ISO) N-methyl-4-phenylpyridinium (EXP) NADP zwitterion (EXP,ISO) NADP(+) (EXP,ISO) nickel atom (ISO) niclosamide (ISO) Nutlin-3 (ISO) okadaic acid (ISO) paracetamol (ISO) phenylmercury acetate (ISO) potassium bromate (ISO) progesterone (ISO) promegestone (ISO) propanal (ISO) quercetin (ISO) reactive oxygen species (ISO) resveratrol (ISO) rotenone (ISO) SB 431542 (ISO) sodium arsenite (ISO) tamoxifen (ISO) testosterone (ISO) Triptolide (EXP) tunicamycin (ISO) valproic acid (ISO) vinclozolin (EXP) vincristine (ISO) zoledronic acid (ISO)
Biological Process
cardiac muscle cell apoptotic process (IEA,ISO) cellular response to cobalt ion (IEA,ISO) cellular response to hypoxia (IEA,ISO) DNA damage response (IEA,ISO) fructose 2,6-bisphosphate metabolic process (IEA,ISO) glucose catabolic process to lactate via pyruvate (IEA,ISO) glycolytic process (IEA,ISO) intestinal epithelial cell development (IEA,ISO) mitophagy (IEA,ISO) negative regulation of glucose catabolic process to lactate via pyruvate (IEA,ISO) negative regulation of glycolytic process (IBA,IEA,ISO) negative regulation of mitophagy (IEA,ISO) negative regulation of programmed cell death (IEA,ISO) negative regulation of reactive oxygen species metabolic process (IEA,ISO) positive regulation of cardiac muscle cell apoptotic process (IEA,ISO) positive regulation of DNA repair (IEA,ISO) positive regulation of hexokinase activity (ISO) positive regulation of pentose-phosphate shunt (IEA,ISO) reactive oxygen species metabolic process (IEA,ISO) regulation of pentose-phosphate shunt (IBA,IEA,ISO) regulation of response to DNA damage checkpoint signaling (IEA,ISO) response to gamma radiation (IEA,ISO) response to ischemia (IEA,ISO) response to xenobiotic stimulus (IEA,ISO)
Tigar Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 161,613,306 - 161,632,248 (-) NCBI GRCr8 mRatBN7.2 4 159,927,136 - 159,946,077 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 87,509,809 - 87,510,466 (+) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 4 159,927,139 - 159,946,029 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 166,156,946 - 166,175,860 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 161,939,848 - 161,958,766 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 160,573,896 - 160,592,815 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 159,635,145 - 159,654,108 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 159,635,153 - 159,654,063 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 231,948,786 - 231,966,869 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 163,481,393 - 163,502,412 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 4 148,642,195 - 148,661,115 (-) NCBI Celera Cytogenetic Map 4 q42 NCBI
TIGAR Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 4,321,213 - 4,360,028 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 4,307,763 - 4,360,028 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 4,430,379 - 4,469,194 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 4,300,620 - 4,339,455 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 4,300,631 - 4,332,599 NCBI Celera 12 6,052,425 - 6,091,264 (+) NCBI Celera Cytogenetic Map 12 p13.32 NCBI HuRef 12 4,287,018 - 4,325,825 (+) NCBI HuRef CHM1_1 12 4,429,992 - 4,468,805 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 4,327,996 - 4,366,805 (+) NCBI T2T-CHM13v2.0
Tigar Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 127,062,079 - 127,086,564 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 127,062,079 - 127,086,520 (-) Ensembl GRCm39 Ensembl GRCm38 6 127,085,116 - 127,109,552 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 127,085,116 - 127,109,557 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 127,035,134 - 127,059,570 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 127,052,982 - 127,075,160 (-) NCBI MGSCv36 mm8 MGSCv36 6 127,984,031 - 128,005,972 (-) NCBI MGSCv36 mm8 Celera 6 128,766,834 - 128,786,116 (-) NCBI Celera Cytogenetic Map 6 F3 NCBI cM Map 6 61.92 NCBI
Tigar Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 2,129,678 - 2,154,380 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 2,129,719 - 2,153,873 (+) NCBI ChiLan1.0 ChiLan1.0
TIGAR Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 9,860,833 - 9,893,058 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 9,857,630 - 9,896,658 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 4,429,945 - 4,462,142 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 4,353,272 - 4,386,758 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 4,353,272 - 4,385,380 (+) Ensembl panpan1.1 panPan2
TIGAR Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 40,521,751 - 40,549,304 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 40,523,314 - 40,549,332 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 6,132,902 - 6,160,282 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 40,877,557 - 40,905,336 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 40,877,558 - 40,905,335 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 40,815,806 - 40,843,030 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 40,791,244 - 40,818,291 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 5,543,778 - 5,570,944 (+) NCBI UU_Cfam_GSD_1.0
Tigar Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 104,632,126 - 104,665,630 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936606 4,518,584 - 4,540,114 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936606 4,518,525 - 4,540,109 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TIGAR Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 66,044,686 - 66,067,377 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 66,044,679 - 66,067,571 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 68,266,609 - 68,289,947 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TIGAR Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 4,354,911 - 4,381,762 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 4,355,053 - 4,381,273 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666063 3,861,799 - 3,888,740 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tigar
.
6478754 Anxrr43 Anxiety related response QTL 43 0.14035 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 144639524 182687754 Rat 724558 Plsm2 Polydactyly-luxate syndrome (PLS) morphotypes QTL 2 0.0003 hindlimb integrity trait (VT:0010563) hind foot phalanges count (CMO:0001949) 4 132422778 177422778 Rat 1582237 Kidm34 Kidney mass QTL 34 4 0.0001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 4 148090542 168069246 Rat 6478693 Anxrr32 Anxiety related response QTL 32 0.00092 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 144639524 182687754 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 631683 Bp116 Blood pressure QTL 116 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 124303370 169303370 Rat 61451 Ciaa4 CIA Autoantibody QTL 4 3.1 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 4 126395976 167139601 Rat 1331738 Bp209 Blood pressure QTL 209 2.979 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 138503169 179293946 Rat 6478700 Anxrr33 Anxiety related response QTL 33 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 1298524 Oia8 Oil induced arthritis QTL 8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 10053718 Scort25 Serum corticosterone level QTL 25 2.15 0.0097 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 155561574 182687754 Rat 1549827 Scl46 Serum cholesterol level QTL 46 3.5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 132396220 177396220 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 7411558 Bw133 Body weight QTL 133 13.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 125590636 170590636 Rat 6478778 Anxrr51 Anxiety related response QTL 51 0.25384 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 124778595 169778595 Rat 10401796 Kidm48 Kidney mass QTL 48 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 145568712 182687754 Rat 6478718 Anxrr34 Anxiety related response QTL 34 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 631511 Pia7 Pristane induced arthritis QTL 7 4.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 1300109 Rf13 Renal function QTL 13 3.91 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 4 157710145 182687754 Rat 634347 Hcar8 Hepatocarcinoma resistance QTL 8 5.8 liver integrity trait (VT:0010547) liver tumorous lesion area to total liver area ratio (CMO:0001075) 4 123143783 168143783 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 2303623 Vencon2 Ventilatory control QTL 2 3.8 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 4 135204660 180204660 Rat 1578674 Bmd12 Bone mineral density QTL 12 3.8 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 4 135699135 180699135 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 61422 Cia13 Collagen induced arthritis QTL 13 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 132642577 167139601 Rat 634342 Cia24 Collagen induced arthritis QTL 24 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 146565735 175236377 Rat 737978 Pia23 Pristane induced arthritis QTL 23 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 61362 Oia2 Oil induced arthritis QTL 2 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 2293659 Bmd35 Bone mineral density QTL 35 4.5 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 4 137755016 181392681 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 724535 Cm18 Cardiac mass QTL 18 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 4 118856416 163856416 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 6478748 Anxrr42 Anxiety related response QTL 42 0.28008 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 12798525 Anxrr57 Anxiety related response QTL 57 3.21 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 147278504 167139601 Rat
D4Mit25
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 159,940,316 - 159,940,457 (+) MAPPER mRatBN7.2 Rnor_6.0 4 159,648,325 - 159,648,465 NCBI Rnor6.0 Rnor_5.0 4 231,953,550 - 231,953,690 UniSTS Rnor5.0 RGSC_v3.4 4 163,495,153 - 163,495,293 UniSTS RGSC3.4 RGSC_v3.4 4 163,495,152 - 163,495,293 RGD RGSC3.4 RGSC_v3.1 4 163,740,089 - 163,740,229 RGD Celera 4 148,655,370 - 148,655,510 UniSTS RH 3.4 Map 4 1003.6 RGD RH 3.4 Map 4 1003.6 UniSTS Cytogenetic Map 4 q42 UniSTS
D4Got310
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 161,626,889 - 161,627,079 (+) Marker Load Pipeline mRatBN7.2 4 159,940,720 - 159,940,910 (+) MAPPER mRatBN7.2 Rnor_6.0 4 159,648,729 - 159,648,916 NCBI Rnor6.0 Rnor_5.0 4 231,953,099 - 231,953,286 UniSTS Rnor5.0 RGSC_v3.4 4 163,495,557 - 163,496,365 UniSTS RGSC3.4 RGSC_v3.4 4 163,495,557 - 163,495,744 UniSTS RGSC3.4 Celera 4 148,655,774 - 148,655,961 UniSTS Cytogenetic Map 4 q42 UniSTS
RH128614
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 159,927,286 - 159,927,487 (+) MAPPER mRatBN7.2 Rnor_6.0 4 159,635,296 - 159,635,496 NCBI Rnor6.0 Rnor_5.0 4 231,966,518 - 231,966,718 UniSTS Rnor5.0 RGSC_v3.4 4 163,481,539 - 163,481,739 UniSTS RGSC3.4 Celera 4 148,642,341 - 148,642,541 UniSTS RH 3.4 Map 4 1009.1 UniSTS Cytogenetic Map 4 q42 UniSTS
BF386144
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 159,928,629 - 159,928,796 (-) MAPPER mRatBN7.2 mRatBN7.2 4 159,928,629 - 159,928,796 (+) MAPPER mRatBN7.2 mRatBN7.2 6 87,510,667 - 87,510,834 (-) MAPPER mRatBN7.2 mRatBN7.2 6 87,510,667 - 87,510,834 (+) MAPPER mRatBN7.2 Rnor_6.0 6 91,332,590 - 91,332,756 NCBI Rnor6.0 Rnor_6.0 4 159,636,639 - 159,636,805 NCBI Rnor6.0 Rnor_5.0 4 231,965,209 - 231,965,375 UniSTS Rnor5.0 Rnor_5.0 6 100,794,516 - 100,794,682 UniSTS Rnor5.0 RGSC_v3.4 4 163,482,882 - 163,483,048 UniSTS RGSC3.4 RGSC_v3.4 6 91,001,278 - 91,001,444 UniSTS RGSC3.4 Celera 6 86,015,520 - 86,015,686 UniSTS Celera 4 148,643,684 - 148,643,850 UniSTS RH 3.4 Map 6 549.8 UniSTS Cytogenetic Map 4 q42 UniSTS Cytogenetic Map 6 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000091662 ⟹ ENSRNOP00000074722
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 159,927,144 - 159,946,025 (-) Ensembl Rnor_6.0 Ensembl 4 159,635,153 - 159,654,063 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000098356 ⟹ ENSRNOP00000088153
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 159,927,143 - 159,946,029 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000111057 ⟹ ENSRNOP00000092807
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 159,927,139 - 159,945,993 (-) Ensembl
RefSeq Acc Id:
NM_001025064 ⟹ NP_001020235
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 161,613,306 - 161,632,229 (-) NCBI mRatBN7.2 4 159,927,136 - 159,946,061 (-) NCBI Rnor_6.0 4 159,635,150 - 159,654,063 (-) NCBI Rnor_5.0 4 231,948,786 - 231,966,869 (+) NCBI RGSC_v3.4 4 163,481,393 - 163,502,412 (-) RGD Celera 4 148,642,195 - 148,661,115 (-) RGD
Sequence:
CGGAAGTAGTGCAGGCAAAGTGGACCTGCAGTCAGTCGCAGCAAGGTGCTGCAGAGTCGGGTTGTGGCTCACGTGCCTTGGACCAAGATGCCGCGCTTCGCCTTGACCATCATCCGCCAGGCAAGGAG
hide sequence
RefSeq Acc Id:
NM_001395051 ⟹ NP_001381980
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 161,613,306 - 161,632,229 (-) NCBI mRatBN7.2 4 159,927,136 - 159,946,061 (-) NCBI
RefSeq Acc Id:
XM_039108258 ⟹ XP_038964186
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 161,613,311 - 161,632,248 (-) NCBI mRatBN7.2 4 159,927,138 - 159,946,077 (-) NCBI
RefSeq Acc Id:
NP_001020235 ⟸ NM_001025064
- Peptide Label:
isoform 2
- UniProtKB:
Q566D2 (UniProtKB/TrEMBL), A0A8I6A442 (UniProtKB/TrEMBL)
- Sequence:
MYGVAEGKPLSELRAMAKAAGEECPMFTPPGGETVEQVKMRGKDFFDFICQLILGKAGQRENFLPGAPDNCLESSLAEVFPVGKHGSLGTDPKHGALGLTASILVVSHGAYMRSLFGYFLSDLRCSLP
hide sequence
Ensembl Acc Id:
ENSRNOP00000074722 ⟸ ENSRNOT00000091662
RefSeq Acc Id:
XP_038964186 ⟸ XM_039108258
- Peptide Label:
isoform X1
- UniProtKB:
Q566D2 (UniProtKB/TrEMBL), A0A8I6A442 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000088153 ⟸ ENSRNOT00000098356
Ensembl Acc Id:
ENSRNOP00000092807 ⟸ ENSRNOT00000111057
RefSeq Acc Id:
NP_001381980 ⟸ NM_001395051
- Peptide Label:
isoform 1
- UniProtKB:
A0A8I6AIY8 (UniProtKB/TrEMBL), A6ILX2 (UniProtKB/TrEMBL), A0A0G2K8S8 (UniProtKB/TrEMBL)
RGD ID: 13693420 Promoter ID: EPDNEW_R3945 Type: initiation region Name: Tigar_1 Description: TP53 induced glycolysis regulatory phosphatase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 159,654,056 - 159,654,116 EPDNEW
BioCyc Gene G2FUF-42949 BioCyc
BioCyc Pathway PWY66-423 [fructose 2,6-bisphosphate biosynthesis] BioCyc
BioCyc Pathway Image PWY66-423 BioCyc
Ensembl Genes ENSRNOG00000046064 Ensembl, UniProtKB/TrEMBL
ENSRNOG00000051816 Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000071048.2 UniProtKB/TrEMBL
ENSRNOT00000091662 ENTREZGENE
ENSRNOT00000091662.2 UniProtKB/TrEMBL
ENSRNOT00000098356.1 UniProtKB/TrEMBL
ENSRNOT00000111057.1 UniProtKB/TrEMBL
Gene3D-CATH 3.40.50.1240 UniProtKB/TrEMBL
IMAGE_CLONE IMAGE:7319640 IMAGE-MGC_LOAD
InterPro His_Pase_superF_clade-1 UniProtKB/TrEMBL
His_PPase_superfam UniProtKB/TrEMBL
PG/BPGM_mutase_AS UniProtKB/TrEMBL
Phosphoglycerate_Mutase UniProtKB/TrEMBL
KEGG Report rno:502894 UniProtKB/TrEMBL
MGC_CLONE MGC:105772 IMAGE-MGC_LOAD
NCBI Gene 502894 ENTREZGENE
PANTHER FRUCTOSE-2,6-BISPHOSPHATASE TIGAR UniProtKB/TrEMBL
FRUCTOSE-2,6-BISPHOSPHATASE TIGAR UniProtKB/TrEMBL
Pfam His_Phos_1 UniProtKB/TrEMBL
PhenoGen Tigar PhenoGen
PROSITE PG_MUTASE UniProtKB/TrEMBL
RatGTEx ENSRNOG00000046064 RatGTEx
ENSRNOG00000051816 RatGTEx
SMART PGAM UniProtKB/TrEMBL
Superfamily-SCOP SSF53254 UniProtKB/TrEMBL
UniProt A0A0G2K8S8 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6A442 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6A9E3_RAT UniProtKB/TrEMBL
A0A8I6AIY8 ENTREZGENE, UniProtKB/TrEMBL
A6ILX2 ENTREZGENE, UniProtKB/TrEMBL
Q566D2 ENTREZGENE, UniProtKB/TrEMBL
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-04-17
Tigar
TP53 induced glycolysis regulatory phosphatase
LOC502894
hypothetical protein LOC502894
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-02-09
LOC502894
hypothetical protein LOC502894
Symbol and Name status set to provisional
70820 PROVISIONAL
