Symbol:
Mavs
Name:
mitochondrial antiviral signaling protein
RGD ID:
1359371
Description:
Predicted to enable several functions, including CARD domain binding activity; RIG-I binding activity; and molecular condensate scaffold activity. Predicted to be involved in several processes, including positive regulation of cytokine production; regulation of DNA-templated transcription; and regulation of defense response. Predicted to act upstream of or within RIG-I signaling pathway and positive regulation of type I interferon production. Predicted to be located in mitochondrion and peroxisomal membrane. Predicted to be active in mitochondrial outer membrane. Orthologous to human MAVS (mitochondrial antiviral signaling protein); PARTICIPATES IN hepatitis C pathway; influenza A pathway; measles pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
interferon beta promoter stimulator protein 1; interferon-beta promoter stimulator protein 1; IPS-1; MGC93707; mitochondrial antiviral-signaling protein; similar to RIKEN cDNA D430028G21; virus-induced signaling adapter; virus-induced signaling adaptor; virus-induced-signaling adapter; Visa
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MAVS (mitochondrial antiviral signaling protein) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Mavs (mitochondrial antiviral signaling protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mavs (mitochondrial antiviral signaling protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MAVS (mitochondrial antiviral signaling protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MAVS (mitochondrial antiviral signaling protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mavs (mitochondrial antiviral signaling protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MAVS (mitochondrial antiviral signaling protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MAVS (mitochondrial antiviral signaling protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mavs (mitochondrial antiviral signaling protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CTNNA1 (catenin alpha 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
MAVS (mitochondrial antiviral signaling protein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Mavs (mitochondrial antiviral signaling protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mavs (mitochondrial antiviral signaling protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
mavs
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 138,904,673 - 138,919,129 (+) NCBI GRCr8 mRatBN7.2 3 118,451,650 - 118,466,094 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 118,451,743 - 118,466,094 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 122,346,068 - 122,360,237 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 130,945,435 - 130,959,618 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 128,602,173 - 128,616,342 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 123,776,147 - 123,790,572 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 123,776,181 - 123,790,567 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 130,273,531 - 130,287,792 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 118,938,433 - 118,953,081 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 118,844,005 - 118,858,653 (+) NCBI Celera 3 117,259,863 - 117,274,017 (+) NCBI Celera Cytogenetic Map 3 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mavs Rat (1->4)-beta-D-glucan multiple interactions ISO Mavs (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of MAVS mRNA CTD PMID:36331819 Mavs Rat 1,2-dimethylhydrazine multiple interactions ISO Mavs (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MAVS mRNA CTD PMID:22206623 Mavs Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MAVS mRNA CTD PMID:18465118 Mavs Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:32119087 Mavs Rat 4,4'-sulfonyldiphenol decreases methylation ISO Mavs (Mus musculus) 6480464 bisphenol S results in decreased methylation of MAVS exon CTD PMID:33297965 Mavs Rat 4,4'-sulfonyldiphenol increases expression ISO MAVS (Homo sapiens) 6480464 bisphenol S results in increased expression of MAVS protein CTD PMID:34186270 Mavs Rat 4,4'-sulfonyldiphenol affects expression ISO MAVS (Homo sapiens) 6480464 bisphenol S affects the expression of MAVS protein CTD PMID:31945527 Mavs Rat 4,4'-sulfonyldiphenol increases expression ISO Mavs (Mus musculus) 6480464 bisphenol S results in increased expression of MAVS mRNA CTD PMID:39298647 Mavs Rat 5-aza-2'-deoxycytidine increases expression ISO Mavs (Mus musculus) 6480464 Decitabine results in increased expression of MAVS mRNA CTD PMID:27923600 Mavs Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of MAVS mRNA CTD PMID:30047161 Mavs Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of MAVS mRNA CTD PMID:31881176 Mavs Rat acrylamide decreases expression ISO MAVS (Homo sapiens) 6480464 Acrylamide results in decreased expression of MAVS mRNA CTD PMID:32763439 Mavs Rat aflatoxin B1 decreases expression ISO Mavs (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of MAVS mRNA CTD PMID:19770486 Mavs Rat arsane affects methylation ISO MAVS (Homo sapiens) 6480464 Arsenic affects the methylation of MAVS gene CTD PMID:25304211 Mavs Rat arsenic atom affects methylation ISO MAVS (Homo sapiens) 6480464 Arsenic affects the methylation of MAVS gene CTD PMID:25304211 Mavs Rat arsenite(3-) multiple interactions ISO MAVS (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to MAVS mRNA] CTD PMID:32406909 Mavs Rat beauvericin increases expression ISO MAVS (Homo sapiens) 6480464 beauvericin results in increased expression of MAVS mRNA CTD PMID:29203277 Mavs Rat benzo[a]pyrene decreases expression ISO Mavs (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of MAVS mRNA CTD PMID:19770486 Mavs Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of MAVS mRNA CTD PMID:25181051 Mavs Rat bisphenol A multiple interactions ISO MAVS (Homo sapiens) 6480464 [[ginger extract results in increased abundance of Oils and Volatile] which co-treated with bisphenol A] affects the expression of MAVS protein CTD PMID:33376534 Mavs Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MAVS mRNA CTD PMID:30816183 and PMID:34947998 Mavs Rat Bisphenol B increases expression ISO MAVS (Homo sapiens) 6480464 bisphenol B results in increased expression of MAVS protein CTD PMID:34186270 Mavs Rat bisphenol F increases expression ISO Mavs (Mus musculus) 6480464 bisphenol F results in increased expression of MAVS mRNA CTD PMID:38685157 Mavs Rat bisphenol F increases expression ISO MAVS (Homo sapiens) 6480464 bisphenol F results in increased expression of MAVS protein CTD PMID:34186270 Mavs Rat Brodifacoum decreases expression EXP 6480464 bromfenacoum results in decreased expression of MAVS protein CTD PMID:28903499 Mavs Rat butanal decreases expression ISO MAVS (Homo sapiens) 6480464 butyraldehyde results in decreased expression of MAVS mRNA CTD PMID:26079696 Mavs Rat cadmium atom multiple interactions ISO MAVS (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of MAVS mRNA CTD PMID:35301059 Mavs Rat cadmium dichloride increases expression ISO MAVS (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of MAVS mRNA CTD PMID:38382870 Mavs Rat cadmium dichloride multiple interactions ISO MAVS (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of MAVS mRNA CTD PMID:35301059 Mavs Rat caffeine affects phosphorylation ISO MAVS (Homo sapiens) 6480464 Caffeine affects the phosphorylation of MAVS protein CTD PMID:35688186 Mavs Rat chromium(6+) multiple interactions ISO MAVS (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of MAVS mRNA CTD PMID:38479592 Mavs Rat cisplatin decreases expression ISO MAVS (Homo sapiens) 6480464 Cisplatin results in decreased expression of MAVS mRNA CTD PMID:27594783 Mavs Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of MAVS mRNA CTD PMID:22465980 Mavs Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of MAVS mRNA CTD PMID:22465980 Mavs Rat copper(II) sulfate increases expression ISO MAVS (Homo sapiens) 6480464 Copper Sulfate results in increased expression of MAVS mRNA CTD PMID:19549813 Mavs Rat coumarin decreases phosphorylation ISO MAVS (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of MAVS protein CTD PMID:35688186 Mavs Rat dextran sulfate multiple interactions ISO Mavs (Mus musculus) 6480464 Erianin inhibits the reaction [Dextran Sulfate results in decreased expression of MAVS protein] CTD PMID:32272095 Mavs Rat dextran sulfate decreases expression ISO Mavs (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of MAVS protein CTD PMID:32272095 Mavs Rat dicrotophos increases expression ISO MAVS (Homo sapiens) 6480464 dicrotophos results in increased expression of MAVS mRNA CTD PMID:28302478 Mavs Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of MAVS mRNA CTD PMID:33729688 Mavs Rat dorsomorphin multiple interactions ISO MAVS (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MAVS mRNA CTD PMID:27188386 Mavs Rat doxorubicin decreases expression ISO MAVS (Homo sapiens) 6480464 Doxorubicin results in decreased expression of MAVS mRNA CTD PMID:29803840 Mavs Rat enzyme inhibitor multiple interactions ISO MAVS (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of MAVS protein CTD PMID:23301498 Mavs Rat epoxiconazole decreases expression ISO Mavs (Mus musculus) 6480464 epoxiconazole results in decreased expression of MAVS mRNA CTD PMID:35436446 Mavs Rat folic acid multiple interactions ISO Mavs (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MAVS mRNA CTD PMID:22206623 Mavs Rat FR900359 decreases phosphorylation ISO MAVS (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of MAVS protein CTD PMID:37730182 Mavs Rat glyphosate increases expression ISO Mavs (Mus musculus) 6480464 Glyphosate results in increased expression of MAVS protein CTD PMID:36173347 Mavs Rat hydrogen peroxide increases expression ISO MAVS (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of MAVS protein CTD PMID:25321315 Mavs Rat hydroxychloroquine increases expression ISO MAVS (Homo sapiens) 6480464 Hydroxychloroquine results in increased expression of MAVS mRNA and Hydroxychloroquine results in increased expression of MAVS protein CTD PMID:25321315 Mavs Rat hydroxychloroquine multiple interactions ISO MAVS (Homo sapiens) 6480464 phenyl-N-tert-butylnitrone inhibits the reaction [Hydroxychloroquine results in increased expression of MAVS protein] CTD PMID:25321315 Mavs Rat hydroxychloroquine increases expression ISO Mavs (Mus musculus) 6480464 Hydroxychloroquine results in increased expression of MAVS mRNA CTD PMID:25321315 Mavs Rat ivermectin decreases expression ISO MAVS (Homo sapiens) 6480464 Ivermectin results in decreased expression of MAVS protein CTD PMID:32959892 Mavs Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of MAVS mRNA CTD PMID:20080153 Mavs Rat lipopolysaccharide multiple interactions ISO MAVS (Homo sapiens) 6480464 MAVS protein affects the reaction [Lipopolysaccharides affects the localization of RELA protein] more ... CTD PMID:27183587 Mavs Rat methamphetamine increases expression ISO Mavs (Mus musculus) 6480464 Methamphetamine results in increased expression of MAVS mRNA CTD PMID:36914120 Mavs Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of MAVS mRNA CTD PMID:30047161 Mavs Rat methyl methanesulfonate decreases expression ISO MAVS (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of MAVS mRNA CTD PMID:23649840 Mavs Rat morphine increases expression EXP 6480464 Morphine results in increased expression of MAVS protein CTD PMID:23056601 Mavs Rat N-methyl-4-phenylpyridinium increases expression ISO MAVS (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of MAVS protein CTD PMID:36174668 Mavs Rat N-methyl-4-phenylpyridinium multiple interactions ISO MAVS (Homo sapiens) 6480464 MIR29A inhibits the reaction [1-Methyl-4-phenylpyridinium results in increased expression of MAVS protein] CTD PMID:36174668 Mavs Rat nitrates multiple interactions ISO Mavs (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of MAVS mRNA CTD PMID:35964746 Mavs Rat ozone multiple interactions ISO MAVS (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of MAVS mRNA CTD PMID:35430440 Mavs Rat paracetamol decreases expression ISO MAVS (Homo sapiens) 6480464 Acetaminophen results in decreased expression of MAVS mRNA CTD PMID:21420995 Mavs Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of MAVS mRNA CTD PMID:33387578 Mavs Rat paracetamol increases expression ISO MAVS (Homo sapiens) 6480464 Acetaminophen results in increased expression of MAVS mRNA CTD PMID:22230336 Mavs Rat pentachlorophenol increases expression ISO Mavs (Mus musculus) 6480464 Pentachlorophenol results in increased expression of MAVS mRNA CTD PMID:23892564 Mavs Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Mavs (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of MAVS mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of MAVS mRNA CTD PMID:36331819 Mavs Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of MAVS protein CTD PMID:35544339 Mavs Rat SB 431542 multiple interactions ISO MAVS (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MAVS mRNA CTD PMID:27188386 Mavs Rat silicon dioxide decreases expression ISO Mavs (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of MAVS mRNA CTD PMID:19073995 and PMID:33720480 Mavs Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of MAVS mRNA CTD PMID:19281266 Mavs Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of MAVS mRNA CTD PMID:30047161 Mavs Rat temozolomide increases expression ISO MAVS (Homo sapiens) 6480464 Temozolomide results in increased expression of MAVS mRNA CTD PMID:31758290 Mavs Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of MAVS mRNA CTD PMID:31150632 Mavs Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of MAVS mRNA CTD PMID:34492290 Mavs Rat triptonide decreases expression ISO Mavs (Mus musculus) 6480464 triptonide results in decreased expression of MAVS mRNA CTD PMID:33045310 Mavs Rat trovafloxacin multiple interactions ISO Mavs (Mus musculus) 6480464 [trovafloxacin co-treated with lipopolysaccharide and E coli O55-B5] results in decreased expression of MAVS mRNA CTD PMID:18930950 Mavs Rat valproic acid increases methylation ISO MAVS (Homo sapiens) 6480464 Valproic Acid results in increased methylation of MAVS gene CTD PMID:29154799 Mavs Rat valproic acid affects expression ISO MAVS (Homo sapiens) 6480464 Valproic Acid affects the expression of MAVS mRNA CTD PMID:25979313 Mavs Rat valproic acid decreases expression ISO MAVS (Homo sapiens) 6480464 Valproic Acid results in decreased expression of MAVS mRNA CTD PMID:26272509 more ... Mavs Rat valproic acid multiple interactions ISO MAVS (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MAVS mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (ISO) aflatoxin B1 (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) beauvericin (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (ISO) Brodifacoum (EXP) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) chromium(6+) (ISO) cisplatin (ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) coumarin (ISO) dextran sulfate (ISO) dicrotophos (ISO) dioxygen (EXP) dorsomorphin (ISO) doxorubicin (ISO) enzyme inhibitor (ISO) epoxiconazole (ISO) folic acid (ISO) FR900359 (ISO) glyphosate (ISO) hydrogen peroxide (ISO) hydroxychloroquine (ISO) ivermectin (ISO) ketamine (EXP) lipopolysaccharide (ISO) methamphetamine (ISO) methimazole (EXP) methyl methanesulfonate (ISO) morphine (EXP) N-methyl-4-phenylpyridinium (ISO) nitrates (ISO) ozone (ISO) paracetamol (EXP,ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) rotenone (EXP) SB 431542 (ISO) silicon dioxide (ISO) Soman (EXP) sulfadimethoxine (EXP) temozolomide (ISO) tetrachloromethane (EXP) thioacetamide (EXP) triptonide (ISO) trovafloxacin (ISO) valproic acid (ISO)
Biological Process
activation of innate immune response (ISO,ISS) antiviral innate immune response (ISO) cellular response to exogenous dsRNA (ISO,ISS) cytoplasmic pattern recognition receptor signaling pathway (ISO) defense response to bacterium (ISO,ISS) defense response to virus (IEA) immune system process (IEA) innate immune response (IEA,ISO,ISS) intracellular signal transduction (ISO) negative regulation of viral genome replication (ISO) positive regulation of canonical NF-kappaB signal transduction (ISO) positive regulation of chemokine (C-C motif) ligand 5 production (ISO) positive regulation of defense response to virus by host (ISO,ISS) positive regulation of DNA-binding transcription factor activity (ISO) positive regulation of interferon-alpha production (ISO,ISS) positive regulation of interferon-beta production (ISO,ISS) positive regulation of interleukin-6 production (ISO,ISS) positive regulation of interleukin-8 production (ISO) positive regulation of IP-10 production (ISO) positive regulation of myeloid dendritic cell cytokine production (ISO,ISS) positive regulation of NF-kappaB transcription factor activity (ISO) positive regulation of NLRP3 inflammasome complex assembly (ISO) positive regulation of protein import into nucleus (ISO) positive regulation of response to cytokine stimulus (ISO,ISS) positive regulation of transcription by RNA polymerase II (ISO) positive regulation of tumor necrosis factor production (ISO,ISS) positive regulation of type I interferon production (ISO) positive regulation of type I interferon-mediated signaling pathway (ISO) protein localization to mitochondrion (ISO) regulation of peroxisome organization (ISO) RIG-I signaling pathway (ISO) signal transduction (ISO)
1.
Extrinsic MAVS signaling is critical for Treg maintenance of Foxp3 expression following acute flavivirus infection.
Da Costa A, etal., Sci Rep. 2017 Jan 17;7:40720. doi: 10.1038/srep40720.
2.
Mitochondrial antiviral-signalling protein plays an essential role in host immunity against human metapneumovirus.
Deng J, etal., J Gen Virol. 2015 Aug;96(8):2104-2113. doi: 10.1099/vir.0.000178. Epub 2015 May 7.
3.
Rotavirus VP3 targets MAVS for degradation to inhibit type III interferon expression in intestinal epithelial cells.
Ding S, etal., Elife. 2018 Nov 21;7. pii: 39494. doi: 10.7554/eLife.39494.
4.
Transcriptomic response to Yersinia pestis: RIG-I like receptor signaling response is detrimental to the host against plague.
Du Z, etal., J Genet Genomics. 2014 Jul 20;41(7):379-96. doi: 10.1016/j.jgg.2014.05.006. Epub 2014 Jun 3.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Constitutively Active MAVS Inhibits HIV-1 Replication via Type I Interferon Secretion and Induction of HIV-1 Restriction Factors.
Gupta S, etal., PLoS One. 2016 Feb 5;11(2):e0148929. doi: 10.1371/journal.pone.0148929. eCollection 2016.
7.
RIG-I Signaling Is Critical for Efficient Polyfunctional T Cell Responses during Influenza Virus Infection.
Kandasamy M, etal., PLoS Pathog. 2016 Jul 20;12(7):e1005754. doi: 10.1371/journal.ppat.1005754. eCollection 2016 Jul.
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
GOA pipeline
RGD automated data pipeline
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
MAVS O-GlcNAcylation Is Essential for Host Antiviral Immunity against Lethal RNA Viruses.
Song N, etal., Cell Rep. 2019 Aug 27;28(9):2386-2396.e5. doi: 10.1016/j.celrep.2019.07.085.
12.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
13.
VISA is an adapter protein required for virus-triggered IFN-beta signaling.
Xu LG, etal., Mol Cell 2005 Sep 16;19(6):727-40.
Mavs Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 138,904,673 - 138,919,129 (+) NCBI GRCr8 mRatBN7.2 3 118,451,650 - 118,466,094 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 118,451,743 - 118,466,094 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 122,346,068 - 122,360,237 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 130,945,435 - 130,959,618 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 128,602,173 - 128,616,342 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 123,776,147 - 123,790,572 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 123,776,181 - 123,790,567 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 130,273,531 - 130,287,792 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 118,938,433 - 118,953,081 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 118,844,005 - 118,858,653 (+) NCBI Celera 3 117,259,863 - 117,274,017 (+) NCBI Celera Cytogenetic Map 3 q36 NCBI
MAVS Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 3,846,834 - 3,876,118 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 3,846,799 - 3,876,123 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 3,827,481 - 3,856,765 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 3,775,484 - 3,795,973 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 20 3,889,325 - 3,918,630 (+) NCBI Celera Cytogenetic Map 20 p13 NCBI HuRef 20 3,776,247 - 3,805,626 (+) NCBI HuRef CHM1_1 20 3,827,384 - 3,856,773 (+) NCBI CHM1_1 T2T-CHM13v2.0 20 3,877,778 - 3,907,055 (+) NCBI T2T-CHM13v2.0
Mavs Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 131,075,445 - 131,089,945 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 131,075,983 - 131,089,945 (+) Ensembl GRCm39 Ensembl GRCm38 2 131,234,063 - 131,248,025 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 131,234,063 - 131,248,025 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 131,059,874 - 131,073,761 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 130,925,579 - 130,939,466 (+) NCBI MGSCv36 mm8 Celera 2 132,460,494 - 132,474,382 (+) NCBI Celera Cytogenetic Map 2 F1 NCBI cM Map 2 63.3 NCBI
Mavs Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955415 14,695,438 - 14,703,672 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955415 14,691,918 - 14,704,782 (+) NCBI ChiLan1.0 ChiLan1.0
MAVS Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 4,809,731 - 4,837,991 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 4,806,483 - 4,834,798 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 3,885,044 - 3,903,554 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 3,659,558 - 3,702,397 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 3,659,559 - 3,701,089 (+) Ensembl panpan1.1 panPan2
MAVS Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 17,510,209 - 17,529,286 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 17,512,761 - 17,523,807 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 17,342,451 - 17,353,500 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 17,930,606 - 17,947,974 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 17,930,603 - 17,942,617 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 17,526,451 - 17,537,501 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 17,637,457 - 17,648,500 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 17,965,346 - 17,976,396 (-) NCBI UU_Cfam_GSD_1.0
Mavs Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 166,413,582 - 166,427,872 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936485 14,842,160 - 14,859,202 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936485 14,842,778 - 14,859,163 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MAVS Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 31,850,900 - 31,869,188 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 31,850,646 - 31,869,273 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 36,193,888 - 36,210,273 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MAVS Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 34,534,433 - 34,555,406 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 34,541,229 - 34,552,823 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666071 9,898,086 - 9,918,187 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mavs
.
Predicted Target Of
Count of predictions: 180 Count of miRNA genes: 115 Interacting mature miRNAs: 125 Transcripts: ENSRNOT00000034146 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 2301414 Kidm37 Kidney mass QTL 37 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 70653097 121056321 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 7387306 Bw124 Body weight QTL 124 3.2 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 3 84091273 129091273 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1300111 Rf12 Renal function QTL 12 3.78 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 61017749 121056321 Rat 8694437 Bw167 Body weight QTL 167 22.46 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 3 91797474 136797474 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 1354611 Despr2 Despair related QTL 2 3.03 0.0028 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 3 97084464 142084464 Rat 631649 Bp123 Blood pressure QTL 123 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 89772419 134772419 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1358204 Insglur1 Insulin/glucose ratio QTL 1 3.8 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 3 115638168 135181505 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 12879848 Bw181 Body weght QTL 181 0.015 body mass (VT:0001259) body weight (CMO:0000012) 3 70348525 121056321 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 631665 Bw8 Body weight QTL 8 5.5 body mass (VT:0001259) body weight (CMO:0000012) 3 50437042 119183768 Rat 1331758 Bp207 Blood pressure QTL 207 2.848 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 112287552 135181505 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat 724532 Cm17 Cardiac mass QTL 17 2 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 3 95735366 140735366 Rat
AI502240
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 118,465,695 - 118,465,911 (+) MAPPER mRatBN7.2 Rnor_6.0 3 123,790,174 - 123,790,389 NCBI Rnor6.0 Rnor_5.0 3 130,287,394 - 130,287,609 UniSTS Rnor5.0 RGSC_v3.4 3 118,952,687 - 118,952,902 UniSTS RGSC3.4 Celera 3 117,273,623 - 117,273,838 UniSTS RH 3.4 Map 3 1012.9 UniSTS Cytogenetic Map 3 q36 UniSTS
RH139303
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 118,452,224 - 118,452,348 (+) MAPPER mRatBN7.2 Rnor_6.0 3 123,776,692 - 123,776,815 NCBI Rnor6.0 Rnor_5.0 3 130,274,059 - 130,274,182 UniSTS Rnor5.0 RGSC_v3.4 3 118,938,870 - 118,938,993 UniSTS RGSC3.4 Celera 3 117,260,300 - 117,260,423 UniSTS RH 3.4 Map 3 1016.3 UniSTS Cytogenetic Map 3 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000034146 ⟹ ENSRNOP00000033476
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 118,458,647 - 118,466,094 (+) Ensembl Rnor_6.0 Ensembl 3 123,776,255 - 123,790,567 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000090764 ⟹ ENSRNOP00000073053
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 118,451,743 - 118,466,094 (+) Ensembl Rnor_6.0 Ensembl 3 123,776,181 - 123,789,637 (+) Ensembl
RefSeq Acc Id:
NM_001005556 ⟹ NP_001005556
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 138,904,812 - 138,919,125 (+) NCBI mRatBN7.2 3 118,451,788 - 118,466,090 (+) NCBI Rnor_6.0 3 123,776,255 - 123,790,568 (+) NCBI Rnor_5.0 3 130,273,531 - 130,287,792 (+) NCBI RGSC_v3.4 3 118,938,433 - 118,953,081 (+) RGD Celera 3 117,259,863 - 117,274,017 (+) RGD
Sequence:
TCGCAGCCTGGGTGTGGGTCCTCAGTGCTCTGTGCTCACTGAGGTTGTTCAGGGAGGGGACCTTGGTCAGAGCCGAGTGCTCCTAGGATTTCGCAGGAGCGCCCCGGGCCTGGGCGCTCGGTGCCAGA
hide sequence
RefSeq Acc Id:
XM_006235034 ⟹ XP_006235096
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 138,904,674 - 138,919,129 (+) NCBI mRatBN7.2 3 118,451,650 - 118,466,094 (+) NCBI Rnor_6.0 3 123,776,147 - 123,790,572 (+) NCBI Rnor_5.0 3 130,273,531 - 130,287,792 (+) NCBI
Sequence:
CAATGGCCGCGTGGCTGGCCCCGCCCCACTCCGCCCCTTCATCTGGGAGGGCTCTGCACAGTCG
hide sequence
RefSeq Acc Id:
XM_006235035 ⟹ XP_006235097
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 138,904,736 - 138,919,129 (+) NCBI mRatBN7.2 3 118,451,733 - 118,466,094 (+) NCBI Rnor_6.0 3 123,776,173 - 123,790,572 (+) NCBI Rnor_5.0 3 130,273,531 - 130,287,792 (+) NCBI
Sequence:
CACTCCGCCCCTTCATCTGGGAGGGCTCTGCACAGTCGAACGCGGTCAACCTGTTTCCTAGTCTGGTTTCTTCTTGGTAAGTTCGCAGCCTGGGTGTGGGTCCTCAGTGCTCTGTGCTCACTGAGGTT
hide sequence
RefSeq Acc Id:
XM_006235036 ⟹ XP_006235098
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 138,904,743 - 138,919,129 (+) NCBI mRatBN7.2 3 118,451,754 - 118,466,094 (+) NCBI Rnor_6.0 3 123,776,172 - 123,790,572 (+) NCBI Rnor_5.0 3 130,273,531 - 130,287,792 (+) NCBI
Sequence:
CCACTCCGCCCCTTCATCTGGGAGGGCTCTGCACAGTCGAACGCGGTCAACCTGTTTCCTAGTCTGGTTTCTTCTTGGTGACCTGGGAAAGGAGGAGGAAGGGTTTCACTTGGCTGGCCTCTACAGAG
hide sequence
RefSeq Acc Id:
XM_006235037 ⟹ XP_006235099
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 138,904,812 - 138,919,129 (+) NCBI mRatBN7.2 3 118,451,733 - 118,466,094 (+) NCBI Rnor_6.0 3 123,776,174 - 123,790,572 (+) NCBI Rnor_5.0 3 130,273,531 - 130,287,792 (+) NCBI
Sequence:
ACTCCGCCCCTTCATCTGGGAGGGCTCTGCACAGTCGAACGCGGTCAACCTGTTTCCTAGTCTG
hide sequence
RefSeq Acc Id:
XM_039105011 ⟹ XP_038960939
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 138,904,790 - 138,919,129 (+) NCBI mRatBN7.2 3 118,451,727 - 118,466,094 (+) NCBI
RefSeq Acc Id:
XM_063283774 ⟹ XP_063139844
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 138,906,047 - 138,919,129 (+) NCBI
RefSeq Acc Id:
XM_063283775 ⟹ XP_063139845
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 138,904,731 - 138,919,129 (+) NCBI
RefSeq Acc Id:
XM_063283776 ⟹ XP_063139846
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 138,904,788 - 138,919,129 (+) NCBI
RefSeq Acc Id:
XM_063283778 ⟹ XP_063139848
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 138,904,796 - 138,919,129 (+) NCBI
RefSeq Acc Id:
XM_063283779 ⟹ XP_063139849
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 138,904,787 - 138,919,129 (+) NCBI
RefSeq Acc Id:
XM_063283780 ⟹ XP_063139850
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 138,906,044 - 138,919,129 (+) NCBI
RefSeq Acc Id:
XM_063283781 ⟹ XP_063139851
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 138,904,673 - 138,919,129 (+) NCBI
RefSeq Acc Id:
XM_063283782 ⟹ XP_063139852
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 138,906,043 - 138,916,715 (+) NCBI
RefSeq Acc Id:
NP_001005556 ⟸ NM_001005556
- UniProtKB:
Q66HG9 (UniProtKB/Swiss-Prot), A6HQD4 (UniProtKB/TrEMBL), A0A8L2QH64 (UniProtKB/TrEMBL)
- Sequence:
MTFAEEKTYKYIRYNHSKFCCVDVLEILPYLSCLTTSDQDRLRASYKQLGNQGTLWELFNTLQRRPGWVEVFIRALRICELPGLAEQVTRVYQSYLPPGASLHSLDPLQSPRIPTTVSEPSAFAAGHT
hide sequence
RefSeq Acc Id:
XP_006235096 ⟸ XM_006235034
- Peptide Label:
isoform X1
- UniProtKB:
Q66HG9 (UniProtKB/Swiss-Prot), A6HQD4 (UniProtKB/TrEMBL), A0A8L2QH64 (UniProtKB/TrEMBL)
- Sequence:
MTFAEEKTYKYIRYNHSKFCCVDVLEILPYLSCLTTSDQDRLRASYKQLGNQGTLWELFNTLQRRPGWVEVFIRALRICELPGLAEQVTRVYQSYLPPGASLHSLDPLQSPRIPTTVSEPSAFAAGHT
hide sequence
RefSeq Acc Id:
XP_006235099 ⟸ XM_006235037
- Peptide Label:
isoform X3
- Sequence:
MSGDSLISSPNPPALSPQPSREHPEQEPELGGPSTANVDSVPIATYGPVSPTVSFQPLPRIAPRTNLSPGVTVSALSAKTTLSSSSTGSAFAKGAGDQAKAATCVSTKEGVPTNSVTTSSVPSIKPVP
hide sequence
RefSeq Acc Id:
XP_006235098 ⟸ XM_006235036
- Peptide Label:
isoform X1
- UniProtKB:
Q66HG9 (UniProtKB/Swiss-Prot), A6HQD4 (UniProtKB/TrEMBL), A0A8L2QH64 (UniProtKB/TrEMBL)
- Sequence:
MTFAEEKTYKYIRYNHSKFCCVDVLEILPYLSCLTTSDQDRLRASYKQLGNQGTLWELFNTLQRRPGWVEVFIRALRICELPGLAEQVTRVYQSYLPPGASLHSLDPLQSPRIPTTVSEPSAFAAGHT
hide sequence
RefSeq Acc Id:
XP_006235097 ⟸ XM_006235035
- Peptide Label:
isoform X1
- UniProtKB:
Q66HG9 (UniProtKB/Swiss-Prot), A6HQD4 (UniProtKB/TrEMBL), A0A8L2QH64 (UniProtKB/TrEMBL)
- Sequence:
MTFAEEKTYKYIRYNHSKFCCVDVLEILPYLSCLTTSDQDRLRASYKQLGNQGTLWELFNTLQRRPGWVEVFIRALRICELPGLAEQVTRVYQSYLPPGASLHSLDPLQSPRIPTTVSEPSAFAAGHT
hide sequence
Ensembl Acc Id:
ENSRNOP00000073053 ⟸ ENSRNOT00000090764
Ensembl Acc Id:
ENSRNOP00000033476 ⟸ ENSRNOT00000034146
RefSeq Acc Id:
XP_038960939 ⟸ XM_039105011
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063139851 ⟸ XM_063283781
- Peptide Label:
isoform X2
- UniProtKB:
A0A8L2QH64 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063139845 ⟸ XM_063283775
- Peptide Label:
isoform X1
- UniProtKB:
Q66HG9 (UniProtKB/Swiss-Prot), A6HQD4 (UniProtKB/TrEMBL), A0A8L2QH64 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063139849 ⟸ XM_063283779
- Peptide Label:
isoform X2
- UniProtKB:
A0A8L2QH64 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063139846 ⟸ XM_063283776
- Peptide Label:
isoform X1
- UniProtKB:
Q66HG9 (UniProtKB/Swiss-Prot), A6HQD4 (UniProtKB/TrEMBL), A0A8L2QH64 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063139848 ⟸ XM_063283778
- Peptide Label:
isoform X1
- UniProtKB:
Q66HG9 (UniProtKB/Swiss-Prot), A6HQD4 (UniProtKB/TrEMBL), A0A8L2QH64 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063139852 ⟸ XM_063283782
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063139850 ⟸ XM_063283780
- Peptide Label:
isoform X2
- UniProtKB:
A0A8L2QH64 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063139844 ⟸ XM_063283774
- Peptide Label:
isoform X1
- UniProtKB:
Q66HG9 (UniProtKB/Swiss-Prot), A6HQD4 (UniProtKB/TrEMBL), A0A8L2QH64 (UniProtKB/TrEMBL)
RGD ID: 13692453 Promoter ID: EPDNEW_R2973 Type: initiation region Name: Mavs_1 Description: mitochondrial antiviral signaling protein SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 123,776,210 - 123,776,270 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2010-05-05
Mavs
mitochondrial antiviral signaling protein
Visa
virus-induced signaling adapter
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-06
Visa
virus-induced signaling adapter
MGC93707
similar to RIKEN cDNA D430028G21
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-07-29
MGC93707
similar to RIKEN cDNA D430028G21
Symbol and Name status set to provisional
70820 PROVISIONAL
