Symbol:
Hba-a3
Name:
hemoglobin alpha, adult chain 3
RGD ID:
1359209
Description:
Enables heme binding activity and organic acid binding activity. Contributes to oxygen binding activity. Predicted to be involved in several processes, including nitric oxide transport; oxygen transport; and response to hydrogen peroxide. Part of hemoglobin complex. Human ortholog(s) of this gene implicated in Heinz body anemia; alpha thalassemia; familial erythrocytosis 7; and hemoglobin H disease. Orthologous to human HBA2 (hemoglobin subunit alpha 2); INTERACTS WITH 17beta-estradiol; 2,3,7,8-Tetrachlorodibenzofuran; 3,3',4,4',5-pentachlorobiphenyl.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
alpha-globin; Glnc1; GloA; globin c1; globin, alpha; Hba-a1; hemoglobin alpha, adult chain 1; LOC287167
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 15,816,099 - 15,816,943 (-) NCBI GRCr8 mRatBN7.2 10 15,311,637 - 15,312,481 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 15,311,634 - 15,312,481 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_WKY_Bbb_1.0 10 15,039,603 - 15,040,447 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 15,577,249 - 15,577,977 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 15,577,249 - 15,577,977 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 15,472,343 - 15,473,071 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 15,558,815 - 15,559,543 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 15,559,862 - 15,560,591 (-) NCBI Celera 10 14,979,302 - 14,980,030 (-) NCBI Celera Cytogenetic Map 10 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hba-a3 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of HBA2 mRNA CTD PMID:32145629 Hba-a3 Rat 17beta-estradiol multiple interactions ISO HBA2 (Homo sapiens) 6480464 [Progesterone co-treated with Estradiol] results in increased expression of HBA2 mRNA CTD PMID:17404688 Hba-a3 Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:32109520 Hba-a3 Rat 2-bromohexadecanoic acid multiple interactions ISO HBA2 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of HBA2 protein] CTD PMID:38195004 Hba-a3 Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions EXP 6480464 [3 more ... CTD PMID:30744511 Hba-a3 Rat 3,4,5,3',4',5'-Hexachlorobiphenyl multiple interactions EXP 6480464 [3 more ... CTD PMID:30744511 Hba-a3 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one multiple interactions ISO HBA2 (Homo sapiens) 6480464 [Benzo(a)pyrene co-treated with 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone] results in increased expression of HBA2 mRNA CTD PMID:20146248 Hba-a3 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of HBA-A3 mRNA CTD PMID:31881176 Hba-a3 Rat Alisol A multiple interactions EXP 6480464 [alisol A co-treated with alisol A 24-acetate co-treated with alisol B co-treated with alisol B 23-acetate co-treated with alisol C 23-acetate co-treated with alisol F co-treated with alisol F 24-acetate] results in increased expression of HBA-A3 mRNA CTD PMID:33035272 Hba-a3 Rat Alisol B multiple interactions EXP 6480464 [alisol A co-treated with alisol A 24-acetate co-treated with alisol B co-treated with alisol B 23-acetate co-treated with alisol C 23-acetate co-treated with alisol F co-treated with alisol F 24-acetate] results in increased expression of HBA-A3 mRNA CTD PMID:33035272 Hba-a3 Rat Alisol C 23-acetate multiple interactions EXP 6480464 [alisol A co-treated with alisol A 24-acetate co-treated with alisol B co-treated with alisol B 23-acetate co-treated with alisol C 23-acetate co-treated with alisol F co-treated with alisol F 24-acetate] results in increased expression of HBA-A3 mRNA CTD PMID:33035272 Hba-a3 Rat antimycin A increases expression ISO HBA2 (Homo sapiens) 6480464 Antimycin A results in increased expression of HBA2 mRNA CTD PMID:33512557 Hba-a3 Rat benzo[a]pyrene affects methylation ISO HBA2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of HBA2 promoter CTD PMID:27901495 Hba-a3 Rat benzo[a]pyrene multiple interactions ISO HBA2 (Homo sapiens) 6480464 [Benzo(a)pyrene co-treated with 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone] results in increased expression of HBA2 mRNA CTD PMID:20146248 Hba-a3 Rat bis(2-ethylhexyl) phthalate increases expression ISO HBA2 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of HBA2 mRNA CTD PMID:31163220 Hba-a3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of HBA2 mRNA CTD PMID:30903817 and PMID:32145629 Hba-a3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of HBA-A3 mRNA CTD PMID:35192832 Hba-a3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of HBA-A3 mRNA CTD PMID:32528016 Hba-a3 Rat butanal increases expression ISO HBA2 (Homo sapiens) 6480464 butyraldehyde results in increased expression of HBA2 mRNA CTD PMID:26079696 Hba-a3 Rat cadmium atom multiple interactions ISO HBA2 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of HBA2 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of HBA2 protein CTD PMID:38195004 Hba-a3 Rat cadmium atom affects binding ISO HBA2 (Homo sapiens) 6480464 HBA2 protein binds to Cadmium CTD PMID:23896426 Hba-a3 Rat cadmium dichloride decreases expression ISO HBA2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of HBA2 mRNA CTD PMID:38382870 Hba-a3 Rat cadmium dichloride multiple interactions ISO HBA2 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of HBA2 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of HBA2 protein CTD PMID:38195004 Hba-a3 Rat capecitabine decreases expression ISO HBA2 (Homo sapiens) 6480464 Capecitabine results in decreased expression of HBA2 mRNA CTD PMID:36183961 Hba-a3 Rat chlorohydrocarbon multiple interactions EXP 6480464 [Hydrocarbons and Chlorinated co-treated with Polychlorinated Biphenyls co-treated with methylmercuric chloride] results in decreased expression of HBA-A3 mRNA CTD PMID:30744511 Hba-a3 Rat copper atom affects binding ISO HBA2 (Homo sapiens) 6480464 HBA2 protein binds to Copper CTD PMID:23896426 Hba-a3 Rat copper(0) affects binding ISO HBA2 (Homo sapiens) 6480464 HBA2 protein binds to Copper CTD PMID:23896426 Hba-a3 Rat corosolic acid increases expression ISO HBA2 (Homo sapiens) 6480464 corosolic acid results in increased expression of HBA2 mRNA CTD PMID:37939859 Hba-a3 Rat deguelin increases expression ISO HBA2 (Homo sapiens) 6480464 deguelin results in increased expression of HBA2 mRNA CTD PMID:33512557 Hba-a3 Rat Dibutyl phosphate affects expression ISO HBA2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of HBA2 mRNA CTD PMID:37042841 Hba-a3 Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of HBA-A3 mRNA CTD PMID:36653537 Hba-a3 Rat doxorubicin decreases expression ISO HBA2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of HBA2 mRNA CTD PMID:29803840 Hba-a3 Rat elemental selenium multiple interactions ISO HBA2 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of HBA2 mRNA CTD PMID:19244175 Hba-a3 Rat flucloxacillin affects binding ISO HBA2 (Homo sapiens) 6480464 Floxacillin binds to HBA2 protein CTD PMID:36782357 Hba-a3 Rat folic acid decreases expression ISO HBA2 (Homo sapiens) 6480464 Folic Acid results in decreased expression of HBA2 mRNA CTD PMID:21867686 Hba-a3 Rat ivermectin decreases expression ISO HBA2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of HBA2 protein CTD PMID:32959892 Hba-a3 Rat menadione affects expression ISO HBA2 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of HBA2 mRNA CTD PMID:20044591 Hba-a3 Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of HBA-A3 mRNA CTD PMID:32035215 Hba-a3 Rat methyl methanesulfonate increases methylation ISO HBA2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased methylation of HBA2 protein CTD PMID:15655799 Hba-a3 Rat methylmercury chloride multiple interactions EXP 6480464 [Hydrocarbons and Chlorinated co-treated with Polychlorinated Biphenyls co-treated with methylmercuric chloride] results in decreased expression of HBA-A3 mRNA CTD PMID:30744511 Hba-a3 Rat methylmercury chloride increases expression ISO HBA2 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of HBA2 mRNA CTD PMID:28001369 Hba-a3 Rat Monobutylphthalate increases expression EXP 6480464 monobutyl phthalate results in increased expression of HBA2 mRNA CTD PMID:29162477 Hba-a3 Rat N-methyl-N-nitrosourea increases carbamoylation ISO HBA2 (Homo sapiens) 6480464 Methylnitrosourea results in increased carbamoylation of HBA2 protein CTD PMID:15655799 Hba-a3 Rat nickel atom affects binding ISO HBA2 (Homo sapiens) 6480464 HBA2 protein binds to Nickel CTD PMID:23896426 Hba-a3 Rat nickel subsulfide decreases expression EXP 6480464 nickel subsulfide results in decreased expression of HBA2 mRNA CTD PMID:21086188 Hba-a3 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of HBA-A3 mRNA CTD PMID:33484710 Hba-a3 Rat paracetamol increases expression ISO HBA2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of HBA2 mRNA CTD PMID:26690555 Hba-a3 Rat pentanal increases expression ISO HBA2 (Homo sapiens) 6480464 pentanal results in increased expression of HBA2 mRNA CTD PMID:26079696 Hba-a3 Rat picoxystrobin increases expression ISO HBA2 (Homo sapiens) 6480464 picoxystrobin results in increased expression of HBA2 mRNA CTD PMID:33512557 Hba-a3 Rat progesterone multiple interactions ISO HBA2 (Homo sapiens) 6480464 [Progesterone co-treated with Estradiol] results in increased expression of HBA2 mRNA CTD PMID:17404688 Hba-a3 Rat progesterone increases expression ISO HBA2 (Homo sapiens) 6480464 Progesterone results in increased expression of HBA2 mRNA CTD PMID:17404688 Hba-a3 Rat propanal increases expression ISO HBA2 (Homo sapiens) 6480464 propionaldehyde results in increased expression of HBA2 mRNA CTD PMID:26079696 Hba-a3 Rat pyrimidifen increases expression ISO HBA2 (Homo sapiens) 6480464 pyrimidifen results in increased expression of HBA2 mRNA CTD PMID:33512557 Hba-a3 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of HBA2 mRNA CTD PMID:28374803 Hba-a3 Rat selenium atom multiple interactions ISO HBA2 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of HBA2 mRNA CTD PMID:19244175 Hba-a3 Rat silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of HBA-A3 mRNA CTD PMID:32721576 and PMID:34779285 Hba-a3 Rat sodium arsenite increases expression ISO HBA2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of HBA2 mRNA CTD PMID:38568856 Hba-a3 Rat tebuconazole decreases expression ISO HBA2 (Homo sapiens) 6480464 tebuconazole results in decreased expression of HBA2 mRNA CTD PMID:30458266 Hba-a3 Rat tebufenpyrad increases expression ISO HBA2 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in increased expression of HBA2 mRNA CTD PMID:33512557 Hba-a3 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of HBA-A3 mRNA CTD PMID:33387578 Hba-a3 Rat triphenyl phosphate affects expression ISO HBA2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of HBA2 mRNA CTD PMID:37042841 Hba-a3 Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of HBA-A3 mRNA CTD PMID:30589522 Hba-a3 Rat urethane increases expression ISO HBA2 (Homo sapiens) 6480464 Urethane results in increased expression of HBA2 mRNA CTD PMID:28818685 Hba-a3 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of HBA2 mRNA CTD PMID:23665938 Hba-a3 Rat valproic acid increases expression ISO HBA2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of HBA2 mRNA CTD PMID:28001369 Hba-a3 Rat vitamin E multiple interactions ISO HBA2 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of HBA2 mRNA CTD PMID:19244175 Hba-a3 Rat zinc atom affects binding ISO HBA2 (Homo sapiens) 6480464 HBA2 protein binds to Zinc CTD PMID:23896426 Hba-a3 Rat zinc(0) affects binding ISO HBA2 (Homo sapiens) 6480464 HBA2 protein binds to Zinc CTD PMID:23896426
17beta-estradiol (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-bromohexadecanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,4,5,3',4',5'-Hexachlorobiphenyl (EXP) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (ISO) acetamide (EXP) Alisol A (EXP) Alisol B (EXP) Alisol C 23-acetate (EXP) antimycin A (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) capecitabine (ISO) chlorohydrocarbon (EXP) copper atom (ISO) copper(0) (ISO) corosolic acid (ISO) deguelin (ISO) Dibutyl phosphate (ISO) diethylstilbestrol (EXP) doxorubicin (ISO) elemental selenium (ISO) flucloxacillin (ISO) folic acid (ISO) ivermectin (ISO) menadione (ISO) methamphetamine (EXP) methyl methanesulfonate (ISO) methylmercury chloride (EXP,ISO) Monobutylphthalate (EXP) N-methyl-N-nitrosourea (ISO) nickel atom (ISO) nickel subsulfide (EXP) nitrofen (EXP) paracetamol (ISO) pentanal (ISO) picoxystrobin (ISO) progesterone (ISO) propanal (ISO) pyrimidifen (ISO) rotenone (EXP) selenium atom (ISO) silicon dioxide (EXP) sodium arsenite (ISO) tebuconazole (ISO) tebufenpyrad (ISO) trichloroethene (EXP) triphenyl phosphate (EXP,ISO) urethane (ISO) valproic acid (EXP,ISO) vitamin E (ISO) zinc atom (ISO) zinc(0) (ISO)
1.
Identification of the molecular genetic defect of patients with methemoglobin M-Kankakee (M-Iwate), alpha87 (F8) His --> Tyr: evidence for an electrostatic model of alphaM hemoglobin assembly.
Ameri A, etal., Blood. 1999 Sep 1;94(5):1825-6.
2.
Increased oxygen affinity with normal heterotropic effects in hemoglobin Loire [alpha 88(F9)Ala----Ser].
Baklouti F, etal., Eur J Biochem. 1988 Nov 1;177(2):307-12.
3.
Three cysteine residues in the alpha chain of rat haemoglobin (albino Rattus norvegicus): 13 (A 11), 104 (G 11) and 111 (G 18).
Chua CG and Carrell RW, Biochim Biophys Acta. 1974 Oct 9;365(2):328-34.
4.
Hemopressin: a novel bioactive peptide derived from the alpha1-chain of hemoglobin.
Dale CS, etal., Mem Inst Oswaldo Cruz. 2005 Mar;100 Suppl 1:105-6. Epub 2005 Jun 14.
5.
Hemoglobin and its derived peptides may play a role in the antibacterial mechanism of the vagina.
Deng L, etal., Hum Reprod. 2009 Jan;24(1):211-8. doi: 10.1093/humrep/den318. Epub 2008 Sep 10.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
Hb Luxembourg [alpha 24(B5) Tyr----His]: a new unstable variant.
Groff P, etal., Hemoglobin. 1989;13(5):429-36.
8.
Structural, functional and conformational properties of rat hemoglobins.
John ME Eur J Biochem. 1982 May 17;124(2):305-10.
9.
Evidence of hemoglobin binding to arsenic as a basis for the accumulation of arsenic in rat blood.
Lu M, etal., Chem Res Toxicol. 2004 Dec;17(12):1733-42.
10.
Hyperunstable hemoglobin Toyama [alpha 2 136(H19)Leu----Arg beta 2]: detection and identification by in vitro biosynthesis with radioactive amino acids.
Ohba Y, etal., Hemoglobin. 1987;11(6):539-56.
11.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
12.
Glutamine synthetase, hemoglobin alpha-chain, and macrophage migration inhibitory factor binding to amyloid beta-protein: their identification in rat brain by a novel affinity chromatography and in Alzheimer's disease brain by immunoprecipitation.
Oyama R, etal., Biochim Biophys Acta. 2000 Jun 15;1479(1-2):91-102.
13.
Initiation codon mutation as a cause of alpha thalassemia.
Pirastu M, etal., J Biol Chem. 1984 Oct 25;259(20):12315-7.
14.
GOA pipeline
RGD automated data pipeline
15.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
Hb Aghia Sophia [alpha62(E11)Val-->0 (alpha1)], an "in-frame" deletion causing alpha-thalassemia.
Traeger-Synodinos J, etal., Hemoglobin. 1999 Nov;23(4):317-24.
Hba-a3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 15,816,099 - 15,816,943 (-) NCBI GRCr8 mRatBN7.2 10 15,311,637 - 15,312,481 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 15,311,634 - 15,312,481 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_WKY_Bbb_1.0 10 15,039,603 - 15,040,447 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 15,577,249 - 15,577,977 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 15,577,249 - 15,577,977 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 15,472,343 - 15,473,071 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 15,558,815 - 15,559,543 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 15,559,862 - 15,560,591 (-) NCBI Celera 10 14,979,302 - 14,980,030 (-) NCBI Celera Cytogenetic Map 10 q12 NCBI
HBA2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 172,876 - 173,710 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 172,876 - 173,710 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 222,875 - 223,709 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 162,875 - 163,708 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 162,874 - 163,705 NCBI Celera 16 426,165 - 427,036 (+) NCBI Celera Cytogenetic Map 16 p13.3 NCBI HuRef 16 140,887 - 141,750 (+) NCBI HuRef CHM1_1 16 222,852 - 223,715 (+) NCBI CHM1_1 T2T-CHM13v2.0 16 166,917 - 167,751 (+) NCBI T2T-CHM13v2.0
LOC100855558 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 40,328,053 - 40,329,002 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 41,591,692 - 41,593,018 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 40,671,209 - 40,672,537 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 6 40,359,320 - 40,360,638 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 40,320,283 - 40,321,596 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 40,798,910 - 40,800,239 (-) NCBI UU_Cfam_GSD_1.0
.
Predicted Target Of
Count of predictions: 34 Count of miRNA genes: 32 Interacting mature miRNAs: 33 Transcripts: ENSRNOT00000052292 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 634329 Pia15 Pristane induced arthritis QTL 15 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 1 24158324 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2293680 Bss40 Bone structure and strength QTL 40 5.66 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 10 1 35225947 Rat 7387235 Uae41 Urinary albumin excretion QTL 41 5.26 0.1874 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 10 1 29497586 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 737820 Alc9 Alcohol consumption QTL 9 2.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 10 5144027 19233348 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 631828 Alc5 Alcohol consumption QTL 5 2.4 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 10 5144027 17245662 Rat 634327 Hc4 Hypercalciuria QTL 4 2.4 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 10 1 38328221 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 631660 Hcar1 Hepatocarcinoma resistance QTL 1 3.4 0.0001 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 10 6154182 15990232 Rat 1576304 Schws7 Schwannoma susceptibility QTL 7 0.0115 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 4765527 19816042 Rat 7411611 Foco17 Food consumption QTL 17 18.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 1 42315980 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
7
49
112
87
86
58
22
58
6
209
94
92
44
55
28
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000048977 ⟹ ENSRNOP00000044081
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 15,311,634 - 15,312,481 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000052292 ⟹ ENSRNOP00000041451
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 10 15,577,249 - 15,577,977 (-) Ensembl
RefSeq Acc Id:
NM_001013853 ⟹ NP_001013875
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 15,816,099 - 15,816,943 (-) NCBI mRatBN7.2 10 15,311,637 - 15,312,481 (-) NCBI Rnor_6.0 10 15,577,249 - 15,577,977 (-) NCBI Rnor_5.0 10 15,472,343 - 15,473,071 (-) NCBI RGSC_v3.4 10 15,558,815 - 15,559,543 (-) RGD Celera 10 14,979,302 - 14,980,030 (-) RGD
Sequence:
ATGGTGCTCTCTGAAGAAGACAAAAACAACATCAAGAAAGCCTGGGTGAAGATTGGTAACCATGCTGCTGAAATTGGCGCAGAGACCATAGGGAGGTTGTTCATTGTCTTCCCCTCCTCCAAGACCTA
hide sequence
RefSeq Acc Id:
NP_001013875 ⟸ NM_001013853
- UniProtKB:
Q63910 (UniProtKB/TrEMBL), A0A0G2JSV6 (UniProtKB/TrEMBL), A0A9K3Y8D0 (UniProtKB/TrEMBL)
- Sequence:
MVLSEEDKNNIKKAWVKIGNHAAEIGAETIGRLFIVFPSSKTYFPHFNTSEGSDQVKAHGKKVADALTNAASHLDDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLASHHPGDFTPAMHASLDK
hide sequence
Ensembl Acc Id:
ENSRNOP00000041451 ⟸ ENSRNOT00000052292
Ensembl Acc Id:
ENSRNOP00000044081 ⟸ ENSRNOT00000048977
RGD ID: 13697073 Promoter ID: EPDNEW_R7598 Type: multiple initiation site Name: Hba-a3_1 Description: hemoglobin alpha, adult chain 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 15,578,008 - 15,578,068 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-31
Hba-a3l
hemoglobin alpha, adult chain 3-like
Hba-a1
hemoglobin alpha, adult chain 1
Name and Symbol changed
629549 APPROVED
2015-12-31
Hba-a3
hemoglobin alpha, adult chain 3
Hba-a3l
hemoglobin alpha, adult chain 3-like
Name and Symbol changed
629549 APPROVED
2015-10-06
Hba-a1
hemoglobin alpha, adult chain 1
LOC287167
globin, alpha
Name and Symbol changed
629549 APPROVED
2005-12-06
LOC287167
globin, alpha
Symbol and Name updated
1559027 APPROVED
2005-07-29
LOC287167
globin, alpha
Symbol and Name status set to provisional
70820 PROVISIONAL
