Symbol:
Cryz
Name:
crystallin zeta
RGD ID:
1311639
Description:
Enables mRNA 3'-UTR binding activity. Predicted to be involved in protein homotetramerization and xenobiotic catabolic process. Predicted to be located in mitochondrion. Predicted to be active in cytosol. Orthologous to human CRYZ (crystallin zeta); INTERACTS WITH (+)-schisandrin B; 2,2,2-tetramine; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
crystallin, zeta; crystallin, zeta (quinone reductase); LOC362061; NADPH:quinone reductase; quinone oxidoreductase; zeta-crystallin
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CRYZ (crystallin zeta) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Cryz (crystallin, zeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cryz (crystallin zeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CRYZ (crystallin zeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CRYZ (crystallin zeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cryz (crystallin zeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CRYZ (crystallin zeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CRYZ (crystallin zeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cryz (crystallin zeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CRYZ (crystallin zeta)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cryz (crystallin, zeta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cryz (crystallin, zeta (quinone reductase))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
F39B2.3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ZTA1
Alliance
DIOPT (Ensembl Compara|Hieranoid)
Xenopus tropicalis (tropical clawed frog):
cryz
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 246,211,707 - 246,239,472 (+) NCBI GRCr8 mRatBN7.2 2 243,552,037 - 243,580,369 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 243,552,119 - 243,579,758 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 251,382,444 - 251,410,059 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 249,276,271 - 249,303,886 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 244,175,870 - 244,204,081 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 260,884,315 - 260,911,827 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 260,884,337 - 260,911,792 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 279,545,988 - 279,573,507 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 252,433,559 - 252,461,038 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 252,448,165 - 252,475,644 (+) NCBI Celera 2 235,475,252 - 235,504,548 (+) NCBI Celera Cytogenetic Map 2 q45 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cryz Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of CRYZ mRNA] CTD PMID:31150632 Cryz Rat (1->4)-beta-D-glucan multiple interactions ISO Cryz (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of CRYZ mRNA CTD PMID:36331819 Cryz Rat 1,2-dimethylhydrazine decreases expression ISO Cryz (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of CRYZ mRNA CTD PMID:22206623 Cryz Rat 1,2-dimethylhydrazine multiple interactions ISO Cryz (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CRYZ mRNA CTD PMID:22206623 Cryz Rat 17beta-estradiol multiple interactions ISO Cryz (Mus musculus) 6480464 [Polyphenols co-treated with Estradiol] results in increased expression of CRYZ mRNA CTD PMID:30077407 Cryz Rat 17beta-estradiol decreases expression ISO Cryz (Mus musculus) 6480464 Estradiol results in decreased expression of CRYZ mRNA CTD PMID:39298647 Cryz Rat 2,2,2-tetramine multiple interactions EXP 6480464 Trientine inhibits the reaction [Streptozocin results in decreased expression of CRYZ protein] CTD PMID:19634143 Cryz Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO CRYZ (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CRYZ mRNA CTD PMID:12377990 Cryz Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CRYZ mRNA CTD PMID:33387578 Cryz Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cryz (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CRYZ mRNA CTD PMID:21570461 Cryz Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CRYZ mRNA CTD PMID:21215274 Cryz Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Cryz (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of CRYZ mRNA CTD PMID:15297030 Cryz Rat 2,3,7,8-tetrachlorodibenzodioxine increases activity ISO Cryz (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased activity of CRYZ protein CTD PMID:15297030 Cryz Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Cryz (Mus musculus) 6480464 AHR protein promotes the reaction [Tetrachlorodibenzodioxin results in increased activity of CRYZ protein] more ... CTD PMID:15297030 Cryz Rat 2,4,6-tribromophenol decreases expression ISO CRYZ (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Cryz Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of CRYZ mRNA CTD PMID:21346803 Cryz Rat 2,5-dihydroxybenzoic acid multiple interactions ISO Cryz (Mus musculus) 6480464 2 and 5-dihydroxybenzoic acid inhibits the reaction [Benzoyl Peroxide results in decreased activity of CRYZ protein] CTD PMID:15454305 Cryz Rat 2,6-dimethoxyphenol multiple interactions ISO CRYZ (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of CRYZ protein CTD PMID:38598786 Cryz Rat 2-hydroxypropanoic acid increases expression ISO CRYZ (Homo sapiens) 6480464 Lactic Acid results in increased expression of CRYZ mRNA CTD PMID:30851411 Cryz Rat 2-methylcholine affects expression ISO CRYZ (Homo sapiens) 6480464 beta-methylcholine affects the expression of CRYZ mRNA CTD PMID:21179406 Cryz Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO CRYZ (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of CRYZ protein CTD PMID:31675489 Cryz Rat 3-methylcholanthrene multiple interactions ISO Cryz (Mus musculus) 6480464 AHR protein promotes the reaction [Methylcholanthrene results in increased activity of CRYZ protein] more ... CTD PMID:15297030 Cryz Rat 3-methylcholanthrene increases activity EXP 6480464 Methylcholanthrene results in increased activity of CRYZ protein CTD PMID:19788401 Cryz Rat 3-methylcholanthrene multiple interactions EXP 6480464 sanguinarine inhibits the reaction [Methylcholanthrene results in increased activity of CRYZ protein] CTD PMID:19788401 Cryz Rat 3-methylcholanthrene increases expression ISO Cryz (Mus musculus) 6480464 Methylcholanthrene results in increased expression of CRYZ mRNA CTD PMID:15297030 Cryz Rat 3-methylcholanthrene increases activity ISO Cryz (Mus musculus) 6480464 Methylcholanthrene results in increased activity of CRYZ protein CTD PMID:15297030 Cryz Rat 3H-1,2-dithiole-3-thione increases expression ISO Cryz (Mus musculus) 6480464 1 and 2-dithiol-3-thione results in increased expression of CRYZ CTD PMID:7563217 Cryz Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1 and 2-dithiol-3-thione results in increased expression of CRYZ CTD PMID:7563217 Cryz Rat 4,4'-sulfonyldiphenol increases expression ISO Cryz (Mus musculus) 6480464 bisphenol S results in increased expression of CRYZ mRNA CTD PMID:39298647 Cryz Rat 4,4'-sulfonyldiphenol increases expression ISO CRYZ (Homo sapiens) 6480464 bisphenol S results in increased expression of CRYZ protein CTD PMID:34186270 Cryz Rat 4-hydroxynon-2-enal decreases expression ISO CRYZ (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in decreased expression of CRYZ mRNA CTD PMID:12419474 Cryz Rat 4-nitroquinoline N-oxide increases activity EXP 6480464 4-Nitroquinoline-1-oxide results in increased activity of CRYZ protein CTD PMID:12566915 Cryz Rat 4-nitroquinoline N-oxide multiple interactions EXP 6480464 ethyl-3-(4'-geranyloxy-3'-methoxyphenyl)-2-propenoate inhibits the reaction [4-Nitroquinoline-1-oxide results in increased activity of CRYZ protein] CTD PMID:12566915 Cryz Rat 5-fluorouracil decreases expression ISO CRYZ (Homo sapiens) 6480464 Fluorouracil results in decreased expression of CRYZ mRNA CTD PMID:17982676 Cryz Rat 5-fluorouracil multiple interactions ISO CRYZ (Homo sapiens) 6480464 TP53 protein inhibits the reaction [Fluorouracil results in decreased expression of CRYZ mRNA] CTD PMID:17982676 Cryz Rat aflatoxin B1 affects expression ISO CRYZ (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of CRYZ protein CTD PMID:20106945 Cryz Rat aflatoxin B1 decreases methylation ISO CRYZ (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of CRYZ gene CTD PMID:27153756 Cryz Rat all-trans-retinoic acid decreases expression ISO CRYZ (Homo sapiens) 6480464 Tretinoin results in decreased expression of CRYZ mRNA CTD PMID:33167477 Cryz Rat aristolochic acid A increases expression ISO CRYZ (Homo sapiens) 6480464 aristolochic acid I results in increased expression of CRYZ protein CTD PMID:33212167 Cryz Rat benzatropine multiple interactions ISO CRYZ (Homo sapiens) 6480464 [Cuprizone co-treated with Benztropine] results in decreased expression of CRYZ protein CTD PMID:34122009 Cryz Rat benzo[a]pyrene increases activity ISO Cryz (Mus musculus) 6480464 Benzo(a)pyrene results in increased activity of CRYZ protein CTD PMID:15297030 Cryz Rat benzo[a]pyrene decreases activity ISO Cryz (Mus musculus) 6480464 Benzo(a)pyrene results in decreased activity of CRYZ protein CTD PMID:29019276 Cryz Rat benzo[a]pyrene decreases expression ISO CRYZ (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of CRYZ mRNA CTD PMID:32234424 Cryz Rat benzo[a]pyrene decreases methylation ISO CRYZ (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of CRYZ promoter CTD PMID:27901495 Cryz Rat benzo[a]pyrene increases expression ISO Cryz (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of CRYZ mRNA CTD PMID:15297030 and PMID:22228805 Cryz Rat benzo[a]pyrene multiple interactions ISO Cryz (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of CRYZ mRNA] more ... CTD PMID:15297030 more ... Cryz Rat Benzoyl peroxide multiple interactions ISO Cryz (Mus musculus) 6480464 2 more ... CTD PMID:12804013 more ... Cryz Rat Benzoyl peroxide affects activity ISO Cryz (Mus musculus) 6480464 Benzoyl Peroxide affects the activity of CRYZ protein CTD PMID:15248479 Cryz Rat Benzoyl peroxide decreases activity ISO Cryz (Mus musculus) 6480464 Benzoyl Peroxide results in decreased activity of CRYZ protein CTD PMID:12804013 more ... Cryz Rat beta-ionone increases activity ISO Cryz (Mus musculus) 6480464 beta-ionone results in increased activity of CRYZ protein CTD PMID:31506784 Cryz Rat beta-naphthoflavone increases activity ISO Cryz (Mus musculus) 6480464 beta-Naphthoflavone results in increased activity of CRYZ protein CTD PMID:15297030 Cryz Rat beta-naphthoflavone multiple interactions ISO Cryz (Mus musculus) 6480464 AHR protein promotes the reaction [beta-Naphthoflavone results in increased activity of CRYZ protein] more ... CTD PMID:15297030 Cryz Rat beta-naphthoflavone increases expression ISO Cryz (Mus musculus) 6480464 beta-Naphthoflavone results in increased expression of CRYZ mRNA CTD PMID:15297030 Cryz Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CRYZ mRNA CTD PMID:25181051 more ... Cryz Rat bisphenol A decreases expression ISO CRYZ (Homo sapiens) 6480464 bisphenol A results in decreased expression of CRYZ protein CTD PMID:31675489 Cryz Rat bisphenol A increases methylation ISO Cryz (Mus musculus) 6480464 bisphenol A results in increased methylation of CRYZ promoter CTD PMID:27312807 Cryz Rat bisphenol AF increases expression ISO CRYZ (Homo sapiens) 6480464 bisphenol AF results in increased expression of CRYZ protein CTD PMID:34186270 Cryz Rat Bisphenol B increases expression ISO CRYZ (Homo sapiens) 6480464 bisphenol B results in increased expression of CRYZ protein CTD PMID:34186270 Cryz Rat bisphenol F increases expression ISO Cryz (Mus musculus) 6480464 bisphenol F results in increased expression of CRYZ mRNA CTD PMID:38685157 Cryz Rat bisphenol F increases expression ISO CRYZ (Homo sapiens) 6480464 bisphenol F results in increased expression of CRYZ protein CTD PMID:34186270 Cryz Rat cadmium acetate affects expression EXP 6480464 cadmium acetate affects the expression of CRYZ mRNA CTD PMID:16249259 Cryz Rat cadmium dichloride increases expression ISO CRYZ (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of CRYZ protein CTD PMID:24527689 Cryz Rat cannabidiol increases expression ISO CRYZ (Homo sapiens) 6480464 Cannabidiol results in increased expression of CRYZ protein CTD PMID:34122009 Cryz Rat carvacrol multiple interactions ISO Cryz (Mus musculus) 6480464 carvacrol inhibits the reaction [Benzo(a)pyrene results in decreased activity of CRYZ protein] CTD PMID:29019276 Cryz Rat CGP 52608 multiple interactions ISO CRYZ (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CRYZ gene] CTD PMID:28238834 Cryz Rat cobalt dichloride decreases expression ISO CRYZ (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of CRYZ mRNA CTD PMID:19376846 Cryz Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of CRYZ mRNA CTD PMID:24386269 Cryz Rat copper atom multiple interactions ISO Cryz (Mus musculus) 6480464 Copper inhibits the reaction [Benzo(a)pyrene results in increased expression of CRYZ mRNA] more ... CTD PMID:15297030 Cryz Rat copper atom multiple interactions ISO CRYZ (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of CRYZ mRNA CTD PMID:20971185 Cryz Rat copper atom increases activity ISO Cryz (Mus musculus) 6480464 Copper results in increased activity of CRYZ protein CTD PMID:15297030 Cryz Rat copper(0) multiple interactions ISO Cryz (Mus musculus) 6480464 Copper inhibits the reaction [Benzo(a)pyrene results in increased expression of CRYZ mRNA] more ... CTD PMID:15297030 Cryz Rat copper(0) multiple interactions ISO CRYZ (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of CRYZ mRNA CTD PMID:20971185 Cryz Rat copper(0) increases activity ISO Cryz (Mus musculus) 6480464 Copper results in increased activity of CRYZ protein CTD PMID:15297030 Cryz Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of CRYZ mRNA CTD PMID:26577399 Cryz Rat Cuprizon multiple interactions ISO CRYZ (Homo sapiens) 6480464 [Cuprizone co-treated with Benztropine] results in decreased expression of CRYZ protein CTD PMID:34122009 Cryz Rat cycloartenol multiple interactions ISO Cryz (Mus musculus) 6480464 cycloartenol inhibits the reaction [Benzoyl Peroxide results in decreased activity of CRYZ protein] CTD PMID:12804013 Cryz Rat cyclosporin A decreases expression ISO CRYZ (Homo sapiens) 6480464 Cyclosporine results in decreased expression of CRYZ mRNA CTD PMID:20106945 and PMID:22147139 Cryz Rat Dibutyl phosphate affects expression ISO CRYZ (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of CRYZ mRNA CTD PMID:37042841 Cryz Rat dicrotophos decreases expression ISO CRYZ (Homo sapiens) 6480464 dicrotophos results in decreased expression of CRYZ mRNA CTD PMID:28302478 Cryz Rat doxorubicin increases expression ISO CRYZ (Homo sapiens) 6480464 Doxorubicin results in increased expression of CRYZ mRNA CTD PMID:29803840 Cryz Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of CRYZ mRNA CTD PMID:29391264 Cryz Rat epoxiconazole decreases expression ISO Cryz (Mus musculus) 6480464 epoxiconazole results in decreased expression of CRYZ mRNA CTD PMID:35436446 Cryz Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of CRYZ mRNA CTD PMID:24793618 Cryz Rat folic acid multiple interactions ISO Cryz (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CRYZ mRNA CTD PMID:22206623 Cryz Rat formaldehyde increases expression EXP 6480464 Formaldehyde results in increased expression of CRYZ mRNA CTD PMID:12679049 Cryz Rat furfural multiple interactions ISO CRYZ (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Cryz Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of CRYZ mRNA CTD PMID:22061828 and PMID:33387578 Cryz Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of CRYZ mRNA CTD PMID:24136188 Cryz Rat glyphosate increases methylation EXP 6480464 Glyphosate results in increased methylation of CRYZ gene CTD PMID:31011160 Cryz Rat hydrogen peroxide affects expression ISO CRYZ (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of CRYZ mRNA CTD PMID:20044591 Cryz Rat inulin multiple interactions ISO Cryz (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of CRYZ mRNA CTD PMID:36331819 Cryz Rat isotretinoin multiple interactions ISO Cryz (Mus musculus) 6480464 Isotretinoin inhibits the reaction [Benzoyl Peroxide results in decreased activity of CRYZ protein] CTD PMID:15225900 Cryz Rat ivermectin decreases expression ISO CRYZ (Homo sapiens) 6480464 Ivermectin results in decreased expression of CRYZ protein CTD PMID:32959892 Cryz Rat lead(0) multiple interactions ISO Cryz (Mus musculus) 6480464 AHR protein promotes the reaction [Lead results in increased activity of CRYZ protein] more ... CTD PMID:15297030 Cryz Rat lead(0) increases activity ISO Cryz (Mus musculus) 6480464 Lead results in increased activity of CRYZ protein CTD PMID:15297030 Cryz Rat lupeol multiple interactions ISO Cryz (Mus musculus) 6480464 lupeol inhibits the reaction [Benzoyl Peroxide affects the activity of CRYZ protein] CTD PMID:15248479 Cryz Rat mercury atom multiple interactions ISO Cryz (Mus musculus) 6480464 Mercury promotes the reaction [Benzo(a)pyrene results in increased activity of CRYZ protein] more ... CTD PMID:15297030 Cryz Rat mercury atom increases activity ISO Cryz (Mus musculus) 6480464 Mercury results in increased activity of CRYZ protein CTD PMID:15297030 Cryz Rat mercury(0) multiple interactions ISO Cryz (Mus musculus) 6480464 Mercury promotes the reaction [Benzo(a)pyrene results in increased activity of CRYZ protein] more ... CTD PMID:15297030 Cryz Rat mercury(0) increases activity ISO Cryz (Mus musculus) 6480464 Mercury results in increased activity of CRYZ protein CTD PMID:15297030 Cryz Rat methidathion increases expression ISO Cryz (Mus musculus) 6480464 methidathion results in increased expression of CRYZ mRNA CTD PMID:34813904 Cryz Rat methylmercury chloride increases expression ISO CRYZ (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of CRYZ mRNA CTD PMID:28001369 Cryz Rat Monobutylphthalate increases expression EXP 6480464 monobutyl phthalate results in increased expression of CRYZ mRNA CTD PMID:29162477 Cryz Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine decreases expression ISO CRYZ (Homo sapiens) 6480464 N more ... CTD PMID:12888634 Cryz Rat paracetamol affects expression ISO Cryz (Mus musculus) 6480464 Acetaminophen affects the expression of CRYZ mRNA CTD PMID:17562736 Cryz Rat paracetamol decreases expression ISO CRYZ (Homo sapiens) 6480464 Acetaminophen results in decreased expression of CRYZ mRNA CTD PMID:21420995 and PMID:29067470 Cryz Rat parathion increases expression ISO Cryz (Mus musculus) 6480464 Parathion results in increased expression of CRYZ mRNA CTD PMID:34813904 Cryz Rat perfluorooctane-1-sulfonic acid decreases expression ISO CRYZ (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of CRYZ mRNA CTD PMID:27153767 Cryz Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Cryz (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of CRYZ mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of CRYZ mRNA CTD PMID:36331819 Cryz Rat phenobarbital affects expression ISO CRYZ (Homo sapiens) 6480464 Phenobarbital affects the expression of CRYZ mRNA CTD PMID:19159669 Cryz Rat picoxystrobin increases expression ISO CRYZ (Homo sapiens) 6480464 picoxystrobin results in increased expression of CRYZ mRNA CTD PMID:33512557 Cryz Rat propiconazole decreases expression ISO Cryz (Mus musculus) 6480464 propiconazole results in decreased expression of CRYZ mRNA CTD PMID:21278054 Cryz Rat quercetin increases activity ISO Cryz (Mus musculus) 6480464 Quercetin results in increased activity of CRYZ protein CTD PMID:8968052 Cryz Rat quercetin 4'-O-beta-D-glucopyranoside increases activity ISO Cryz (Mus musculus) 6480464 spiraeoside results in increased activity of CRYZ protein CTD PMID:8968052 Cryz Rat rac-lactic acid increases expression ISO CRYZ (Homo sapiens) 6480464 Lactic Acid results in increased expression of CRYZ mRNA CTD PMID:30851411 Cryz Rat resveratrol increases expression ISO Cryz (Mus musculus) 6480464 resveratrol results in increased expression of CRYZ mRNA CTD PMID:22610192 Cryz Rat resveratrol affects expression EXP 6480464 resveratrol affects the expression of CRYZ mRNA CTD PMID:15748624 Cryz Rat rotenone increases expression ISO CRYZ (Homo sapiens) 6480464 Rotenone results in increased expression of CRYZ mRNA CTD PMID:33512557 Cryz Rat sanguinarine multiple interactions EXP 6480464 sanguinarine inhibits the reaction [Methylcholanthrene results in increased activity of CRYZ protein] CTD PMID:19788401 Cryz Rat sanguinarine decreases activity EXP 6480464 sanguinarine results in decreased activity of CRYZ protein CTD PMID:19788401 Cryz Rat SB 431542 multiple interactions ISO CRYZ (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of CRYZ protein CTD PMID:37664457 Cryz Rat sodium arsenite decreases expression ISO CRYZ (Homo sapiens) 6480464 sodium arsenite results in decreased expression of CRYZ mRNA CTD PMID:29301061 Cryz Rat sodium chloride multiple interactions ISO CRYZ (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of CRYZ protein CTD PMID:38598786 Cryz Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of CRYZ protein CTD PMID:19634143 Cryz Rat streptozocin multiple interactions EXP 6480464 Trientine inhibits the reaction [Streptozocin results in decreased expression of CRYZ protein] CTD PMID:19634143 Cryz Rat sunitinib decreases expression ISO CRYZ (Homo sapiens) 6480464 Sunitinib results in decreased expression of CRYZ mRNA CTD PMID:31533062 Cryz Rat tert-butyl hydroperoxide decreases response to substance ISO Cryz (Mus musculus) 6480464 CRYZ protein results in decreased susceptibility to tert-Butylhydroperoxide CTD PMID:15003993 Cryz Rat tert-butyl hydroperoxide increases expression ISO Cryz (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of CRYZ mRNA CTD PMID:14729362 more ... Cryz Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of CRYZ mRNA] CTD PMID:31150632 Cryz Rat tetrachloromethane decreases expression ISO Cryz (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of CRYZ mRNA CTD PMID:31919559 Cryz Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of CRYZ mRNA CTD PMID:31150632 Cryz Rat tetrahydropalmatine decreases expression ISO CRYZ (Homo sapiens) 6480464 tetrahydropalmatine results in decreased expression of CRYZ protein CTD PMID:20109541 Cryz Rat thapsigargin multiple interactions ISO CRYZ (Homo sapiens) 6480464 Drugs and Chinese Herbal promotes the reaction [Thapsigargin results in increased expression of CRYZ mRNA] CTD PMID:19442820 Cryz Rat thapsigargin decreases expression ISO CRYZ (Homo sapiens) 6480464 Thapsigargin results in decreased expression of CRYZ mRNA CTD PMID:22378314 Cryz Rat thapsigargin increases expression ISO CRYZ (Homo sapiens) 6480464 Thapsigargin results in increased expression of CRYZ mRNA CTD PMID:19442820 Cryz Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of CRYZ mRNA CTD PMID:34492290 Cryz Rat titanium dioxide decreases methylation ISO Cryz (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CRYZ promoter CTD PMID:35295148 Cryz Rat triphenyl phosphate affects expression ISO CRYZ (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CRYZ mRNA CTD PMID:37042841 Cryz Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of CRYZ mRNA CTD PMID:24136188 Cryz Rat valproic acid decreases expression ISO CRYZ (Homo sapiens) 6480464 Valproic Acid results in decreased expression of CRYZ mRNA CTD PMID:29154799 Cryz Rat valproic acid increases expression ISO CRYZ (Homo sapiens) 6480464 Valproic Acid results in increased expression of CRYZ mRNA CTD PMID:19101580 and PMID:28001369 Cryz Rat xanthohumol increases activity ISO Cryz (Mus musculus) 6480464 xanthohumol results in increased activity of CRYZ protein CTD PMID:17590382 Cryz Rat zinc atom decreases expression ISO CRYZ (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of CRYZ mRNA CTD PMID:22171008 Cryz Rat zinc(0) decreases expression ISO CRYZ (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of CRYZ mRNA CTD PMID:22171008
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2,2-tetramine (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 2,5-dihydroxybenzoic acid (ISO) 2,6-dimethoxyphenol (ISO) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-methylcholanthrene (EXP,ISO) 3H-1,2-dithiole-3-thione (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 4-nitroquinoline N-oxide (EXP) 5-fluorouracil (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) Benzoyl peroxide (ISO) beta-ionone (ISO) beta-naphthoflavone (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium acetate (EXP) cadmium dichloride (ISO) cannabidiol (ISO) carvacrol (ISO) CGP 52608 (ISO) cobalt dichloride (EXP,ISO) copper atom (ISO) copper(0) (ISO) Cuprizon (EXP,ISO) cycloartenol (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) doxorubicin (ISO) endosulfan (EXP) epoxiconazole (ISO) flutamide (EXP) folic acid (ISO) formaldehyde (EXP) furfural (ISO) gentamycin (EXP) glafenine (EXP) glyphosate (EXP) hydrogen peroxide (ISO) inulin (ISO) isotretinoin (ISO) ivermectin (ISO) lead(0) (ISO) lupeol (ISO) mercury atom (ISO) mercury(0) (ISO) methidathion (ISO) methylmercury chloride (ISO) Monobutylphthalate (EXP) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) paracetamol (ISO) parathion (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) picoxystrobin (ISO) propiconazole (ISO) quercetin (ISO) quercetin 4'-O-beta-D-glucopyranoside (ISO) rac-lactic acid (ISO) resveratrol (EXP,ISO) rotenone (ISO) sanguinarine (EXP) SB 431542 (ISO) sodium arsenite (ISO) sodium chloride (ISO) streptozocin (EXP) sunitinib (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP,ISO) tetrahydropalmatine (ISO) thapsigargin (ISO) thioacetamide (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) valdecoxib (EXP) valproic acid (ISO) xanthohumol (ISO) zinc atom (ISO) zinc(0) (ISO)
Cryz Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 246,211,707 - 246,239,472 (+) NCBI GRCr8 mRatBN7.2 2 243,552,037 - 243,580,369 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 243,552,119 - 243,579,758 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 251,382,444 - 251,410,059 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 249,276,271 - 249,303,886 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 244,175,870 - 244,204,081 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 260,884,315 - 260,911,827 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 260,884,337 - 260,911,792 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 279,545,988 - 279,573,507 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 252,433,559 - 252,461,038 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 252,448,165 - 252,475,644 (+) NCBI Celera 2 235,475,252 - 235,504,548 (+) NCBI Celera Cytogenetic Map 2 q45 NCBI
CRYZ Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 74,705,486 - 74,733,050 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 74,705,482 - 74,733,408 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 75,171,170 - 75,198,734 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 74,943,772 - 74,971,315 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 74,883,204 - 74,910,748 NCBI Celera 1 73,416,409 - 73,444,324 (-) NCBI Celera Cytogenetic Map 1 p31.1 NCBI HuRef 1 73,305,573 - 73,333,498 (-) NCBI HuRef CHM1_1 1 75,286,617 - 75,314,534 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 74,547,169 - 74,574,691 (-) NCBI T2T-CHM13v2.0
Cryz Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 154,302,348 - 154,328,819 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 154,302,348 - 154,328,819 (+) Ensembl GRCm39 Ensembl GRCm38 3 154,596,711 - 154,623,182 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 154,596,711 - 154,623,182 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 154,259,976 - 154,286,146 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 154,532,492 - 154,558,475 (+) NCBI MGSCv36 mm8 Celera 3 161,056,174 - 161,081,722 (+) NCBI Celera Cytogenetic Map 3 H4 NCBI cM Map 3 79.25 NCBI
Cryz Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955423 17,955,222 - 17,975,982 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955423 17,952,783 - 17,975,982 (+) NCBI ChiLan1.0 ChiLan1.0
CRYZ Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 152,146,290 - 152,174,077 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 151,306,974 - 151,335,349 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 73,933,432 - 73,962,107 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 75,908,684 - 75,936,131 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 75,908,684 - 75,936,127 (-) Ensembl panpan1.1 panPan2
CRYZ Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 71,656,162 - 71,693,020 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 71,656,188 - 71,675,692 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 74,319,317 - 74,339,207 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 72,243,211 - 72,286,494 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 72,243,256 - 72,276,221 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 71,743,227 - 71,762,856 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 71,689,881 - 71,709,606 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 72,184,160 - 72,204,066 (+) NCBI UU_Cfam_GSD_1.0
Cryz Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 86,491,899 - 86,523,098 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936571 2,001,273 - 2,024,974 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936571 2,002,388 - 2,033,423 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CRYZ Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 138,435,392 - 138,460,975 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 138,434,960 - 138,461,042 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 128,301,994 - 128,327,414 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CRYZ Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 58,427,281 - 58,456,370 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 58,435,671 - 58,456,408 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 58,998,854 - 59,027,683 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cryz
.
Predicted Target Of
Count of predictions: 108 Count of miRNA genes: 84 Interacting mature miRNAs: 100 Transcripts: ENSRNOT00000032808 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
631563 Hcuc3 Hepatic copper content QTL 3 3.87 liver copper amount (VT:0003065) liver copper weight to liver dry weight ratio (CMO:0001512) 2 229059610 249053267 Rat 1298075 Scl17 Serum cholesterol level QTL 17 3.4 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 211744537 249053267 Rat 2293833 Kiddil8 Kidney dilation QTL 8 2.9 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 219753301 247136170 Rat 1598835 Anxrr18 Anxiety related response QTL 18 2.98 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 2 200990457 245990457 Rat 1300126 Bp175 Blood pressure QTL 175 3.46 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 214226044 247136170 Rat 7207490 Bss111 Bone structure and strength QTL 111 6.4 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 2 211744537 249053267 Rat 7207484 Bss108 Bone structure and strength QTL 108 5.3 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 2 211744537 249053267 Rat 7411555 Bw132 Body weight QTL 132 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 2 223389739 249053267 Rat 9587428 Epfw6 Epididymal fat weight QTL 6 7.47 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 2 223389739 249053267 Rat 7207482 Bss107 Bone structure and strength QTL 107 7 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 2 211744537 249053267 Rat 2293844 Kiddil7 Kidney dilation QTL 7 3.5 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 219753301 247136170 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 2317752 Glom23 Glomerulus QTL 23 3.6 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 2 193452645 245889826 Rat 1549836 Bss2 Bone structure and strength QTL 2 7.5 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 2 211744537 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 2317885 Alcrsp28 Alcohol response QTL 28 2.1 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 212828222 249053267 Rat
RH131206
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 243,579,419 - 243,579,616 (+) MAPPER mRatBN7.2 Rnor_6.0 2 260,911,489 - 260,911,685 NCBI Rnor6.0 Rnor_5.0 2 279,573,169 - 279,573,365 UniSTS Rnor5.0 RGSC_v3.4 2 252,460,734 - 252,460,930 UniSTS RGSC3.4 Celera 2 235,504,244 - 235,504,440 UniSTS RH 3.4 Map 2 1630.2 UniSTS Cytogenetic Map 2 q45 UniSTS
RH132950
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 243,578,997 - 243,579,189 (+) MAPPER mRatBN7.2 Rnor_6.0 2 260,911,067 - 260,911,258 NCBI Rnor6.0 Rnor_5.0 2 279,572,747 - 279,572,938 UniSTS Rnor5.0 RGSC_v3.4 2 252,460,312 - 252,460,503 UniSTS RGSC3.4 Celera 2 235,503,822 - 235,504,013 UniSTS RH 3.4 Map 2 1637.8 UniSTS Cytogenetic Map 2 q45 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000032808 ⟹ ENSRNOP00000038188
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 243,552,119 - 243,579,758 (+) Ensembl Rnor_6.0 Ensembl 2 260,884,337 - 260,911,792 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000117940 ⟹ ENSRNOP00000077429
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 243,557,442 - 243,579,758 (+) Ensembl
RefSeq Acc Id:
NM_001012183 ⟹ NP_001012183
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 246,211,825 - 246,239,438 (+) NCBI mRatBN7.2 2 243,552,111 - 243,579,724 (+) NCBI Rnor_6.0 2 260,884,339 - 260,911,793 (+) NCBI Rnor_5.0 2 279,545,988 - 279,573,507 (+) NCBI RGSC_v3.4 2 252,433,559 - 252,461,038 (+) RGD Celera 2 235,475,252 - 235,504,548 (+) RGD
Sequence:
CCGCCCATCTCTTTTCCTAAGGAACTTCTGGAGTTTAGGAGGTTTGATTCCTACTGTAGAGGAGGATCACCATGGCAACTGGACAGAAGTTGATGAGGGCTATTCGAGTGTTTGAATTTGGTGGACCG
hide sequence
RefSeq Acc Id:
XM_006233520 ⟹ XP_006233582
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 246,211,707 - 246,239,472 (+) NCBI mRatBN7.2 2 243,552,038 - 243,580,369 (+) NCBI Rnor_6.0 2 260,884,315 - 260,911,827 (+) NCBI Rnor_5.0 2 279,545,988 - 279,573,507 (+) NCBI
Sequence:
CTTTCAAAGTTAGGAAAAGCCCGCCCGCCCATCTCTTTTCCTAAGGAACTTCTGGAGTTTAGGA
hide sequence
RefSeq Acc Id:
XM_063282242 ⟹ XP_063138312
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 246,211,747 - 246,234,351 (+) NCBI
RefSeq Acc Id:
NP_001012183 ⟸ NM_001012183
- UniProtKB:
Q6AYT0 (UniProtKB/Swiss-Prot), A6HWQ3 (UniProtKB/TrEMBL), A0A8I5Y5T4 (UniProtKB/TrEMBL)
- Sequence:
MATGQKLMRAIRVFEFGGPEVLKLQSDVVVPAPQSHQVLIKVHACGVNPVETYIRSGTYSRKPALPYTPGSDVAGIIESVGDGVSAFKKGDRVFCFSTVSGGYAEFALSADNTTYPLPETLDFRQGAA
hide sequence
RefSeq Acc Id:
XP_006233582 ⟸ XM_006233520
- Peptide Label:
isoform X1
- UniProtKB:
Q6AYT0 (UniProtKB/Swiss-Prot), A6HWQ3 (UniProtKB/TrEMBL), A0A8I5Y5T4 (UniProtKB/TrEMBL)
- Sequence:
MATGQKLMRAIRVFEFGGPEVLKLQSDVVVPAPQSHQVLIKVHACGVNPVETYIRSGTYSRKPALPYTPGSDVAGIIESVGDGVSAFKKGDRVFCFSTVSGGYAEFALSADNTTYPLPETLDFRQGAA
hide sequence
Ensembl Acc Id:
ENSRNOP00000038188 ⟸ ENSRNOT00000032808
Ensembl Acc Id:
ENSRNOP00000077429 ⟸ ENSRNOT00000117940
RefSeq Acc Id:
XP_063138312 ⟸ XM_063282242
- Peptide Label:
isoform X2
RGD ID: 13691833 Promoter ID: EPDNEW_R2357 Type: multiple initiation site Name: Cryz_1 Description: crystallin zeta SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 260,884,347 - 260,884,407 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-11-19
Cryz
crystallin zeta
Cryz
crystallin, zeta (quinone reductase)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-01-10
Cryz
crystallin, zeta (quinone reductase)
Cryz
crystallin, zeta
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Cryz
crystallin, zeta
Cryz_predicted
crystallin, zeta (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Cryz_predicted
crystallin, zeta (predicted)
Symbol and Name status set to approved
70820 APPROVED
