Advanced Search (OLGA)

Gene: Shq1 (SHQ1, H/ACA ribonucleoprotein assembly factor) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Shq1

Name:

SHQ1, H/ACA ribonucleoprotein assembly factor

RGD ID:

1310610

Description:

Predicted to enable unfolded protein binding activity. Predicted to be involved in box H/ACA snoRNP assembly. Predicted to act upstream of or within with a positive effect on regulation of androgen receptor signaling pathway. Predicted to act upstream of or within positive regulation of TORC1 signaling and telomerase RNA localization to Cajal body. Predicted to be located in cytosol. Predicted to be active in cytoplasm and nucleoplasm. Human ortholog(s) of this gene implicated in dystonia 35, childhood-onset. Orthologous to human SHQ1 (SHQ1, H/ACA ribonucleoprotein assembly factor); INTERACTS WITH 1,3-dinitrobenzene; 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC297483; MGC187748; RGD1310610; SHQ1 homolog; SHQ1 homolog (S. cerevisiae); similar to hypothetical protein FLJ10539

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SHQ1 (SHQ1, H/ACA ribonucleoprotein assembly factor)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Shq1 (SHQ1 homolog (S. cerevisiae))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Shq1 (SHQ1, H/ACA ribonucleoprotein assembly factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SHQ1 (SHQ1, H/ACA ribonucleoprotein assembly factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SHQ1 (SHQ1, H/ACA ribonucleoprotein assembly factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Shq1 (SHQ1, H/ACA ribonucleoprotein assembly factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SHQ1 (SHQ1, H/ACA ribonucleoprotein assembly factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SHQ1 (SHQ1, H/ACA ribonucleoprotein assembly factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Shq1 (SHQ1, H/ACA ribonucleoprotein assembly factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SHQ1 (SHQ1, H/ACA ribonucleoprotein assembly factor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Shq1 (SHQ1 homolog (S. cerevisiae))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	shq1 (SHQ1, H/ACA ribonucleoprotein assembly factor)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG10055	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SHQ1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y48A5A.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	shq1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	134,741,190 - 134,861,960 (-)	NCBI		GRCr8
mRatBN7.2	4	133,213,357 - 133,305,586 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	133,213,361 - 133,305,586 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	138,619,611 - 138,712,091 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	134,400,393 - 134,492,872 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	133,018,641 - 133,111,122 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	133,131,711 - 133,133,170 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0	4	133,037,515 - 133,127,183 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	133,037,014 - 133,131,953 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	197,520,935 - 197,610,595 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	135,478,202 - 135,571,298 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	135,716,517 - 135,821,308 (-)	NCBI
Celera	4	122,058,308 - 122,150,570 (-)	NCBI		Celera
Cytogenetic Map	4	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Shq1	Rat	dystonia 35, childhood-onset		ISO	SHQ1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Dystonia 35 and childhood-onset	ClinVar	PMID:25553844 more ...
Shq1	Rat	NEURODEVELOPMENTAL DISORDER WITH DYSTONIA AND SEIZURES		ISO	SHQ1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder with dystonia and seizures	ClinVar	PMID:25741868 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Shq1	Rat	dystonia 35, childhood-onset		ISO	SHQ1 (Homo sapiens)	7240710		OMIM
Shq1	Rat	NEURODEVELOPMENTAL DISORDER WITH DYSTONIA AND SEIZURES		ISO	SHQ1 (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Shq1	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Shq1 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SHQ1 mRNA	CTD	PMID:36331819
Shq1	Rat	1,2-dichloroethane	decreases expression	ISO	Shq1 (Mus musculus)	6480464	ethylene dichloride results in decreased expression of SHQ1 mRNA	CTD	PMID:28960355
Shq1	Rat	1,2-dimethylhydrazine	increases expression	ISO	Shq1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of SHQ1 mRNA	CTD	PMID:22206623
Shq1	Rat	1,3-dinitrobenzene	decreases expression	EXP		6480464	3-dinitrobenzene results in decreased expression of SHQ1 mRNA	CTD	PMID:21983209
Shq1	Rat	1-naphthyl isothiocyanate	increases expression	EXP		6480464	1-Naphthylisothiocyanate results in increased expression of SHQ1 mRNA	CTD	PMID:30723492
Shq1	Rat	17beta-estradiol	increases expression	ISO	SHQ1 (Homo sapiens)	6480464	Estradiol results in increased expression of SHQ1 mRNA	CTD	PMID:31614463
Shq1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Shq1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of SHQ1 mRNA	CTD	PMID:21570461
Shq1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of SHQ1 mRNA	CTD	PMID:33387578
Shq1	Rat	2-methylcholine	affects expression	ISO	SHQ1 (Homo sapiens)	6480464	beta-methylcholine affects the expression of SHQ1 mRNA	CTD	PMID:21179406
Shq1	Rat	3,4-methylenedioxymethamphetamine	decreases expression	ISO	Shq1 (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of SHQ1 mRNA	CTD	PMID:26251327
Shq1	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SHQ1 mRNA	CTD	PMID:36041667
Shq1	Rat	acrolein	multiple interactions	ISO	SHQ1 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of SHQ1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of SHQ1 mRNA	CTD	PMID:32699268
Shq1	Rat	aflatoxin B1	increases methylation	ISO	SHQ1 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of SHQ1 intron	CTD	PMID:30157460
Shq1	Rat	alpha-pinene	multiple interactions	ISO	SHQ1 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of SHQ1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of SHQ1 mRNA	CTD	PMID:32699268
Shq1	Rat	arsane	multiple interactions	ISO	SHQ1 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SHQ1 mRNA	CTD	PMID:39836092
Shq1	Rat	arsenic atom	multiple interactions	ISO	SHQ1 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SHQ1 mRNA	CTD	PMID:39836092
Shq1	Rat	atrazine	decreases expression	ISO	SHQ1 (Homo sapiens)	6480464	Atrazine results in decreased expression of SHQ1 mRNA	CTD	PMID:22378314
Shq1	Rat	benzo[a]pyrene	affects methylation	ISO	SHQ1 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of SHQ1 intron	CTD	PMID:30157460
Shq1	Rat	benzo[e]pyrene	decreases methylation	ISO	SHQ1 (Homo sapiens)	6480464	benzo(e)pyrene results in decreased methylation of SHQ1 intron	CTD	PMID:30157460
Shq1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of SHQ1 mRNA	CTD	PMID:25181051
Shq1	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SHQ1 mRNA	CTD	PMID:36041667
Shq1	Rat	bisphenol A	multiple interactions	ISO	SHQ1 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of SHQ1 gene	CTD	PMID:31601247
Shq1	Rat	bisphenol A	decreases methylation	ISO	SHQ1 (Homo sapiens)	6480464	bisphenol A results in decreased methylation of SHQ1 gene	CTD	PMID:31601247
Shq1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of SHQ1 mRNA	CTD	PMID:30816183 and PMID:34947998
Shq1	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SHQ1 mRNA	CTD	PMID:36041667
Shq1	Rat	cadmium dichloride	decreases expression	ISO	SHQ1 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of SHQ1 mRNA	CTD	PMID:38568856
Shq1	Rat	carbon nanotube	increases expression	ISO	Shq1 (Mus musculus)	6480464	Nanotubes and Carbon results in increased expression of SHQ1 mRNA	CTD	PMID:25554681
Shq1	Rat	CGP 52608	multiple interactions	ISO	SHQ1 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to SHQ1 gene]	CTD	PMID:28238834
Shq1	Rat	chromium(6+)	multiple interactions	ISO	SHQ1 (Homo sapiens)	6480464	[zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of SHQ1 mRNA	CTD	PMID:38479592
Shq1	Rat	Dibutyl phosphate	affects expression	ISO	SHQ1 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of SHQ1 mRNA	CTD	PMID:37042841
Shq1	Rat	dimethylarsinic acid	decreases expression	ISO	Shq1 (Mus musculus)	6480464	Cacodylic Acid results in decreased expression of SHQ1 mRNA	CTD	PMID:22246474
Shq1	Rat	dioxygen	multiple interactions	ISO	Shq1 (Mus musculus)	6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of SHQ1 mRNA	CTD	PMID:30529165
Shq1	Rat	dorsomorphin	multiple interactions	ISO	SHQ1 (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SHQ1 mRNA	CTD	PMID:27188386
Shq1	Rat	doxorubicin	decreases expression	ISO	SHQ1 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of SHQ1 mRNA	CTD	PMID:29803840
Shq1	Rat	fulvestrant	multiple interactions	ISO	SHQ1 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of SHQ1 gene	CTD	PMID:31601247
Shq1	Rat	ketoconazole	increases expression	EXP		6480464	Ketoconazole results in increased expression of SHQ1 mRNA	CTD	PMID:36653537
Shq1	Rat	methapyrilene	decreases methylation	ISO	SHQ1 (Homo sapiens)	6480464	Methapyrilene results in decreased methylation of SHQ1 intron	CTD	PMID:30157460
Shq1	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of SHQ1 mRNA	CTD	PMID:25729387
Shq1	Rat	ozone	multiple interactions	ISO	SHQ1 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of SHQ1 mRNA more ...	CTD	PMID:32699268
Shq1	Rat	ozone	multiple interactions	ISO	Shq1 (Mus musculus)	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of SHQ1 mRNA	CTD	PMID:34911549
Shq1	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of SHQ1 mRNA	CTD	PMID:33387578
Shq1	Rat	paraquat	increases expression	EXP		6480464	Paraquat results in increased expression of SHQ1 mRNA	CTD	PMID:32680482
Shq1	Rat	perfluorohexanesulfonic acid	decreases expression	ISO	SHQ1 (Homo sapiens)	6480464	perfluorohexanesulfonic acid results in decreased expression of SHQ1 mRNA	CTD	PMID:25812627
Shq1	Rat	perfluorononanoic acid	decreases expression	ISO	SHQ1 (Homo sapiens)	6480464	perfluoro-n-nonanoic acid results in decreased expression of SHQ1 mRNA	CTD	PMID:25812627
Shq1	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Shq1 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SHQ1 mRNA	CTD	PMID:36331819
Shq1	Rat	perfluorooctanoic acid	decreases expression	ISO	SHQ1 (Homo sapiens)	6480464	perfluorooctanoic acid results in decreased expression of SHQ1 mRNA	CTD	PMID:25812627
Shq1	Rat	SB 431542	multiple interactions	ISO	SHQ1 (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SHQ1 mRNA	CTD	PMID:27188386
Shq1	Rat	sodium arsenite	decreases expression	ISO	SHQ1 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of SHQ1 mRNA	CTD	PMID:38568856
Shq1	Rat	sodium arsenite	multiple interactions	ISO	SHQ1 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SHQ1 mRNA	CTD	PMID:39836092
Shq1	Rat	sodium dichromate	increases expression	EXP		6480464	sodium bichromate results in increased expression of SHQ1 mRNA	CTD	PMID:25993096
Shq1	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of SHQ1 mRNA	CTD	PMID:31150632
Shq1	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of SHQ1 mRNA	CTD	PMID:23411599 and PMID:34492290
Shq1	Rat	titanium dioxide	decreases expression	ISO	Shq1 (Mus musculus)	6480464	titanium dioxide results in decreased expression of SHQ1 mRNA	CTD	PMID:29264374
Shq1	Rat	titanium dioxide	decreases methylation	ISO	Shq1 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of SHQ1 gene	CTD	PMID:35295148
Shq1	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of SHQ1 mRNA	CTD	PMID:25729387
Shq1	Rat	triphenyl phosphate	affects expression	ISO	SHQ1 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of SHQ1 mRNA	CTD	PMID:37042841
Shq1	Rat	tungsten	increases expression	ISO	Shq1 (Mus musculus)	6480464	Tungsten results in increased expression of SHQ1 mRNA	CTD	PMID:30912803
Shq1	Rat	valproic acid	affects expression	ISO	SHQ1 (Homo sapiens)	6480464	Valproic Acid affects the expression of SHQ1 mRNA	CTD	PMID:25979313
Shq1	Rat	valproic acid	decreases methylation	ISO	SHQ1 (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of SHQ1 gene	CTD	PMID:29154799
Shq1	Rat	valproic acid	increases expression	ISO	SHQ1 (Homo sapiens)	6480464	Valproic Acid results in increased expression of SHQ1 mRNA	CTD	PMID:23179753 more ...
Shq1	Rat	valproic acid	multiple interactions	ISO	SHQ1 (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SHQ1 mRNA	CTD	PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Shq1	Rat	box H/ACA snoRNP assembly	involved_in	IEA	InterPro:IPR039742	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Shq1	Rat	box H/ACA snoRNP assembly	involved_in	IBA	PANTHER:PTN000311574 and SGD:S000001366	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Shq1	Rat	positive regulation of TORC1 signaling	acts_upstream_of_or_within	ISO	Shq1 (Mus musculus)	1624291	MGI:109583 more ...	RGD	PMID:29057879
Shq1	Rat	positive regulation of TORC1 signaling	acts_upstream_of_or_within	IEA	UniProtKB:Q7TMX5 and ensembl:ENSMUSP00000108938	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Shq1	Rat	protein-RNA complex assembly	involved_in	ISO	SHQ1 (Homo sapiens)	1624291	PMID:19383767	RGD	PMID:19383767
Shq1	Rat	protein-RNA complex assembly	involved_in	IEA	UniProtKB:Q6PI26 and ensembl:ENSP00000315182	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Shq1	Rat	regulation of androgen receptor signaling pathway	acts_upstream_of_or_within_positive_effect	ISO	Shq1 (Mus musculus)	1624291	MGI:109583 more ...	RGD	PMID:29057879
Shq1	Rat	regulation of androgen receptor signaling pathway	acts_upstream_of_or_within_positive_effect	IEA	UniProtKB:Q7TMX5 and ensembl:ENSMUSP00000108938	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Shq1	Rat	telomerase RNA localization to Cajal body	acts_upstream_of_or_within	ISO	SHQ1 (Homo sapiens)	9068941	PMID:25467444	BHF-UCL	PMID:25467444

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Shq1	Rat	Cajal body	NOT\|located_in	ISO	SHQ1 (Homo sapiens)	1624291	PMID:19383767	RGD	PMID:19383767
Shq1	Rat	cytoplasm	located_in	ISO	SHQ1 (Homo sapiens)	1624291	PMID:19383767	RGD	PMID:19383767
Shq1	Rat	cytoplasm	is_active_in	IBA	PANTHER:PTN000311574 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Shq1	Rat	cytoplasm	located_in	IEA	UniProtKB:Q6PI26 and ensembl:ENSP00000315182	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Shq1	Rat	cytosol	located_in	ISO	SHQ1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Shq1	Rat	cytosol	located_in	IEA	UniProtKB:Q6PI26 and ensembl:ENSP00000315182	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Shq1	Rat	nucleolus	NOT\|located_in	ISO	SHQ1 (Homo sapiens)	1624291	PMID:19383767	RGD	PMID:19383767
Shq1	Rat	nucleoplasm	located_in	ISO	SHQ1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Shq1	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q6PI26 and ensembl:ENSP00000315182	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Shq1	Rat	nucleoplasm	is_active_in	IBA	PANTHER:PTN000311574 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Shq1	Rat	nucleoplasm	located_in	ISO	SHQ1 (Homo sapiens)	1624291	PMID:19383767	RGD	PMID:19383767

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Shq1	Rat	protein binding	enables	ISO	SHQ1 (Homo sapiens)	1624291	UniProtKB:O60832 more ...	RGD	PMID:19383767 more ...
Shq1	Rat	unfolded protein binding	enables	IBA	PANTHER:PTN000311574 and SGD:S000001366	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:19383767	PMID:25467444	PMID:39326821

Shq1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	134,741,190 - 134,861,960 (-)	NCBI		GRCr8
mRatBN7.2	4	133,213,357 - 133,305,586 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	133,213,361 - 133,305,586 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	138,619,611 - 138,712,091 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	134,400,393 - 134,492,872 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	133,018,641 - 133,111,122 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	133,131,711 - 133,133,170 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0	4	133,037,515 - 133,127,183 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	133,037,014 - 133,131,953 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	197,520,935 - 197,610,595 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	135,478,202 - 135,571,298 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	135,716,517 - 135,821,308 (-)	NCBI
Celera	4	122,058,308 - 122,150,570 (-)	NCBI		Celera
Cytogenetic Map	4	q34	NCBI

SHQ1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	72,725,272 - 72,848,445 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	72,749,277 - 72,861,914 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	72,798,428 - 72,897,596 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	72,881,118 - 72,980,288 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	72,881,119 - 72,980,288	NCBI
Celera	3	72,732,591 - 72,831,743 (-)	NCBI		Celera
Cytogenetic Map	3	p13	NCBI
HuRef	3	72,801,901 - 72,901,021 (-)	NCBI		HuRef
CHM1_1	3	72,751,223 - 72,850,430 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	72,766,887 - 72,890,317 (-)	NCBI		T2T-CHM13v2.0

Shq1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	100,548,772 - 100,648,135 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	100,545,217 - 100,648,118 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	100,571,811 - 100,671,183 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	100,568,256 - 100,671,157 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	100,523,076 - 100,621,151 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	100,539,181 - 100,637,239 (-)	NCBI		MGSCv36	mm8
Celera	6	102,439,542 - 102,537,888 (-)	NCBI		Celera
Cytogenetic Map	6	D3	NCBI
cM Map	6	46.82	NCBI

Shq1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955421	15,358,221 - 15,457,097 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955421	15,358,387 - 15,455,534 (+)	NCBI	ChiLan1.0	ChiLan1.0

SHQ1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	72,707,607 - 72,808,233 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	72,712,395 - 72,812,355 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	72,692,338 - 72,791,784 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	74,619,864 - 74,718,948 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	74,619,864 - 74,718,948 (-)	Ensembl	panpan1.1		panPan2

SHQ1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	19,304,839 - 19,406,662 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	19,304,934 - 19,405,950 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	19,283,815 - 19,385,285 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	19,340,247 - 19,442,546 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	19,340,246 - 19,442,541 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	19,027,021 - 19,128,703 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	19,369,028 - 19,470,788 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	19,440,373 - 19,542,402 (+)	NCBI		UU_Cfam_GSD_1.0

Shq1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404942	3,831,838 - 3,900,478 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936603	3,831,018 - 3,900,971 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936603	3,831,838 - 3,900,429 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SHQ1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	54,071,659 - 54,180,750 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	54,073,012 - 54,180,759 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	59,745,978 - 59,900,437 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SHQ1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	33,691,625 - 33,799,128 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	33,691,120 - 33,795,450 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	132,968,901 - 133,077,325 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Shq1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624773	7,235,240 - 7,355,680 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624773	7,242,326 - 7,355,619 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Shq1
271 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	170
Count of miRNA genes:	134
Interacting mature miRNAs:	149
Transcripts:	ENSRNOT00000057758
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	85253748	148090731	Rat
631689	Scl4	Serum cholesterol level QTL 4	1.9	0.008	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	95174120	140174120	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
1578655	Bmd11	Bone mineral density QTL 11	11		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	4	90850165	135850165	Rat
1300116	Hrtrt5	Heart rate QTL 5	3.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	116179486	151161268	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	26775591	168368347	Rat
631683	Bp116	Blood pressure QTL 116		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	124303370	169303370	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	126395976	167139601	Rat
1549827	Scl46	Serum cholesterol level QTL 46	3.5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	132396220	177396220	Rat
731165	Uae21	Urinary albumin excretion QTL 21	2.4	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	106649412	151649412	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	109866907	167139601	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	125590636	170590636	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	109827074	154827074	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82798864	152731274	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
70201	Gcr1	Gastric cancer resistance QTL 1	2.7		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	4	120260281	147278687	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
1331759	Hrtrt13	Heart rate QTL 13	3.54628		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	110275411	168266883	Rat
724535	Cm18	Cardiac mass QTL 18	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	4	118856416	163856416	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
2302049	Pia32	Pristane induced arthritis QTL 32	5.1	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	105789505	150789505	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	132422778	177422778	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	119428175	157578333	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	109827074	154827074	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	124778595	169778595	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	106805662	151805662	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	123143783	168143783	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
61422	Cia13	Collagen induced arthritis QTL 13	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	132642577	167139601	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
2293840	Kiddil9	Kidney dilation QTL 9	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	4	120926564	148090731	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	114627026	159627026	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	85253748	150276390	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	103194656	148194656	Rat
12798527	Anxrr58	Anxiety related response QTL 58	4.11	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	119463257	147278687	Rat

RH130438

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	12,408,755 - 12,408,938 (+)	MAPPER	mRatBN7.2
mRatBN7.2	4	133,230,710 - 133,230,893 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	133,054,869 - 133,055,051	NCBI	Rnor6.0
Rnor_6.0	3	7,659,747 - 7,659,929	NCBI	Rnor6.0
Rnor_5.0	4	197,538,289 - 197,538,471	UniSTS	Rnor5.0
Rnor_5.0	3	13,008,310 - 13,008,492	UniSTS	Rnor5.0
RGSC_v3.4	3	8,086,971 - 8,087,153	UniSTS	RGSC3.4
RGSC_v3.4	4	135,495,556 - 135,495,738	UniSTS	RGSC3.4
Celera	4	122,075,660 - 122,075,842	UniSTS
Celera	3	7,187,977 - 7,188,159	UniSTS
Cytogenetic Map	4	q34	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001134713	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008763162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008763164	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592565	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285848	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285849	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285850	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285851	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285852	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285853	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285854	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285855	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285856	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285857	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285858	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285859	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285860	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC168172	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000057758 ⟹ ENSRNOP00000054569

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	133,213,361 - 133,305,586 (-)	Ensembl
Rnor_6.0 Ensembl	4	133,037,519 - 133,127,175 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000089177 ⟹ ENSRNOP00000070645

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	4	133,037,014 - 133,131,953 (-)	Ensembl

RefSeq Acc Id:

NM_001134713 ⟹ NP_001128185

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	134,769,721 - 134,861,945 (-)	NCBI
mRatBN7.2	4	133,213,357 - 133,305,586 (-)	NCBI
Rnor_6.0	4	133,037,515 - 133,127,175 (-)	NCBI
Rnor_5.0	4	197,520,935 - 197,610,595 (-)	NCBI
RGSC_v3.4	4	135,478,202 - 135,571,298 (-)	RGD
Celera	4	122,058,308 - 122,150,570 (-)	RGD

Sequence:

show sequence

CCGGAAGCGCTGTGGCAGACGGCTTGGGTCTGTCGCGTGGGTACTTGTCGCGTGTCTAGCCGGTGGTGGCTTCAGGCGCGCGCAACGATGCTAACTCCTGCGTTCGAACTGACCCAGGACCGCGACTT
CCTTACCGTCGCCATCCGCGTGCCCCACGCGCGCGCCTCCGAGTTCGACGTGTACTTCGAGGGGGTGGACTTCAAGTTCTACGCCAAGCCGTACTTTCTGAGGTTAACACTTCCTGGAAGGATTGTAG
AAAATGGATCTGAGCAGGGATCCTATGATGCAGATAAAGGAATTTTTACCATTCGATTGCCCAAGGAAACTCCTGGCCAGCATTTTGAGGGGCTGAACATGTTAACTGCGCTTCTGGCACCAAGAAAA
TCCAGGTCTGCCAAACCGCTTGTGGAAGAAATAGGTGCTTCCGGGGTTTCTGAGGAAGGAGCTGATGATGAGGATGAAGAGTTTGACTGGGAAATTGAGCAGACTCCCTATGAAGAGGTCTCAGAAAG
TACTCTGCGATCGCAGTGTCACTATGGATTTGGAAACCTGCGAGCAGGTGTGGTTCAGCGGTTACAGGATGAACTGAGTGAGGTTATCGATATTAAGGATCCAGATTTCACTCCTGTGACTGAACGGA
GGCAGAAACGCCTGGCCGCTGAATTGGCCAAATTTGATCCAGATCATTATCTAGCTGACTTCTTTGAAGATGAGGCAGTTGAACAGGTTTTGAAGTACAGTCCTTGGTGGAACGATGTGCACACAGAA
ATGATGGCCTCTTTGGGAAAGAGCCAAGAGCAAGGGGATGCTGCTGCCTTAGTATCTTTTTCAGAAGAGGAAAAATACCAGCTACGAAAGTTTGTGAATAAATCTTACCTGCTGGACAAGACAGCTCA
CCGTCAAGTGTACTATAGTTTAGTTGACATCCTTCTGGCCTATTGCTATGAAGTACGTGTGACTGAAGGAGAGCACAACGTGGAGTCTGCGTGGACCATCAGGAAGCTGAGCCCTACACTCTGCTGGT
TTGAGACATGGACAGACGTTCATGAAATCCTGGTGTCTTTTGGACGGAGAGTTTTGTGCTATCCGCTCTATCGCCATTTCAAGCTGGTGCTGAAAGCCTACAGAGATACTCTAAAGATACTGCAACTC
GGTAAGAGTGCAGTTTTGAAGTGTCTCCTGGATGTTCACAAAATCTTCCAGGAAAACGACCCAGCATATATTTTGAATGATCTCTACATCTCAGACTACTGTGTATGGATTCAGAAGGCCAAGTCCAA
AAAGTTGGCTGCCCTAACAGAAGCTTTGGAAGCAGTCTCACTCAGTAAGGCCCAGCTGGGATTCGAGCTGCTAGAACTGGAAGCTGCTGCAATTCTTGTCCAGGAGGAAGAAACTGCCGGAAAGACAG
CCCAGTGCAGTCCTACAGAGCAGGTTCCACACTCCAGCCCTGAGCCCAGTGACTCAGACAGCACCTCATCATCTGACACAGAAGACTCAGCGTCAGTGCAAGAGGAGCTTGTCGGGACCCAGCCCTCC
CTGCTCACTTCTCTGCAAGTCCCCCTTTTGGAAGAGGACAGTGCCCTGACCATCAGAGATAGTGGGCTCTGCAGAAACATGGGCAGTCAGAAATGTGAAGTTCGTCAAGGTCAGCCACTGGCCTCTCC
CCGGGCTCCTCTGATAGAGGAGGTTGGAGATAGTGGACTCTGCAGAAACATGGCCAGCCAGGGATGTGAAGTCAGTCAAGAGCAGCCACTGGCCTCTCCCCGGGCTCCTCTGATAGAGGAGGTTGGAG
ATGAACTGAAGACCATGCTTTGGGTTTCCACACCCAGTGGTGTCAATGCTGGGAGCCACAGGAGTGTACAGGATGCAAAGGAGAGGGATCAGGTGCCCTGTGATTGACTTAAGTGGTAGGCTCATTAT
GGGGCACTAGGTCAACTATGATCTCATACAGAAGTGGAATTTCTGATTTTGATTGTGTACATTTTCTGTGTGGATACAGGACATTGTTTTTCAGTGAGCTAACATTTGTACTTTTCAAAGTTTTTATT
TTGCAACTTGAAAAATATACTTCTAAAGTATTCTTTATAAGGTATAAATAATTAAAAATGAAGACCATAGTTCTACTAGGAAAATCTCTAGACCAGTGATTCTCAACCTTCCTAATGCTGTGACCTTT
TAATACAGTTCCTCATGTTGTGGTGACCACCAACTATAAAATTATTTTGTTGCTACTTCATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063285848 ⟹ XP_063141918

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	134,741,190 - 134,861,960 (-)	NCBI

RefSeq Acc Id:

XM_063285849 ⟹ XP_063141919

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	134,741,190 - 134,861,960 (-)	NCBI

RefSeq Acc Id:

XM_063285850 ⟹ XP_063141920

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	134,741,190 - 134,861,960 (-)	NCBI

RefSeq Acc Id:

XM_063285851 ⟹ XP_063141921

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	134,741,190 - 134,861,960 (-)	NCBI

RefSeq Acc Id:

XM_063285852 ⟹ XP_063141922

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	134,741,190 - 134,861,960 (-)	NCBI

RefSeq Acc Id:

XM_063285853 ⟹ XP_063141923

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	134,741,190 - 134,861,960 (-)	NCBI

RefSeq Acc Id:

XM_063285854 ⟹ XP_063141924

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	134,741,190 - 134,861,960 (-)	NCBI

RefSeq Acc Id:

XM_063285855 ⟹ XP_063141925

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	134,741,190 - 134,861,960 (-)	NCBI

RefSeq Acc Id:

XM_063285856 ⟹ XP_063141926

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	134,741,190 - 134,861,960 (-)	NCBI

RefSeq Acc Id:

XM_063285857 ⟹ XP_063141927

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	134,741,190 - 134,861,960 (-)	NCBI

RefSeq Acc Id:

XM_063285858 ⟹ XP_063141928

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	134,741,190 - 134,861,960 (-)	NCBI

RefSeq Acc Id:

XM_063285859 ⟹ XP_063141929

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	134,741,190 - 134,861,960 (-)	NCBI

RefSeq Acc Id:

XM_063285860 ⟹ XP_063141930

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	134,741,190 - 134,861,960 (-)	NCBI


Protein RefSeqs	NP_001128185	(Get FASTA)	NCBI Sequence Viewer
	XP_063141918	(Get FASTA)	NCBI Sequence Viewer
	XP_063141919	(Get FASTA)	NCBI Sequence Viewer
	XP_063141920	(Get FASTA)	NCBI Sequence Viewer
	XP_063141921	(Get FASTA)	NCBI Sequence Viewer
	XP_063141922	(Get FASTA)	NCBI Sequence Viewer
	XP_063141923	(Get FASTA)	NCBI Sequence Viewer
	XP_063141924	(Get FASTA)	NCBI Sequence Viewer
	XP_063141925	(Get FASTA)	NCBI Sequence Viewer
	XP_063141926	(Get FASTA)	NCBI Sequence Viewer
	XP_063141927	(Get FASTA)	NCBI Sequence Viewer
	XP_063141928	(Get FASTA)	NCBI Sequence Viewer
	XP_063141929	(Get FASTA)	NCBI Sequence Viewer
	XP_063141930	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI68172	(Get FASTA)	NCBI Sequence Viewer
	EDL91447	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000054569
	ENSRNOP00000054569.2

RefSeq Acc Id:

NP_001128185 ⟸ NM_001134713

- UniProtKB:

B4F784 (UniProtKB/TrEMBL), A6IBH9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLTPAFELTQDRDFLTVAIRVPHARASEFDVYFEGVDFKFYAKPYFLRLTLPGRIVENGSEQGSYDADKGIFTIRLPKETPGQHFEGLNMLTALLAPRKSRSAKPLVEEIGASGVSEEGADDEDEEFD
WEIEQTPYEEVSESTLRSQCHYGFGNLRAGVVQRLQDELSEVIDIKDPDFTPVTERRQKRLAAELAKFDPDHYLADFFEDEAVEQVLKYSPWWNDVHTEMMASLGKSQEQGDAAALVSFSEEEKYQLR
KFVNKSYLLDKTAHRQVYYSLVDILLAYCYEVRVTEGEHNVESAWTIRKLSPTLCWFETWTDVHEILVSFGRRVLCYPLYRHFKLVLKAYRDTLKILQLGKSAVLKCLLDVHKIFQENDPAYILNDLY
ISDYCVWIQKAKSKKLAALTEALEAVSLSKAQLGFELLELEAAAILVQEEETAGKTAQCSPTEQVPHSSPEPSDSDSTSSSDTEDSASVQEELVGTQPSLLTSLQVPLLEEDSALTIRDSGLCRNMGS
QKCEVRQGQPLASPRAPLIEEVGDSGLCRNMASQGCEVSQEQPLASPRAPLIEEVGDELKTMLWVSTPSGVNAGSHRSVQDAKERDQVPCD

hide sequence

Ensembl Acc Id:

ENSRNOP00000054569 ⟸ ENSRNOT00000057758

Ensembl Acc Id:

ENSRNOP00000070645 ⟸ ENSRNOT00000089177

RefSeq Acc Id:	XP_063141930 ⟸ XM_063285860
- Peptide Label:	isoform X1
- UniProtKB:	B4F784 (UniProtKB/TrEMBL), A6IBH9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063141928 ⟸ XM_063285858
- Peptide Label:	isoform X1
- UniProtKB:	B4F784 (UniProtKB/TrEMBL), A6IBH9 (UniProtKB/TrEMBL)

Protein Domains

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B4F784-F1-model_v2	AlphaFold	B4F784	1-603	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13693275

Promoter ID:

EPDNEW_R3800

Type:

single initiation site

Name:

Shq1_1

Description:

SHQ1, H/ACA ribonucleoprotein assembly factor

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	133,127,164 - 133,127,224	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-43557	BioCyc
Ensembl Genes	ENSRNOG00000005433	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000057758	ENTREZGENE
	ENSRNOT00000057758.3	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.790	UniProtKB/TrEMBL
InterPro	CS-like_domain	UniProtKB/TrEMBL
	HSP20-like_chaperone	UniProtKB/TrEMBL
	SHQ1	UniProtKB/TrEMBL
	Shq1	UniProtKB/TrEMBL
	SHQ1-like_CS	UniProtKB/TrEMBL
KEGG Report	rno:297483	UniProtKB/TrEMBL
NCBI Gene	297483	ENTREZGENE
PANTHER	PROTEIN SHQ1 HOMOLOG	UniProtKB/TrEMBL
	PTHR12967	UniProtKB/TrEMBL
Pfam	SHQ1	UniProtKB/TrEMBL
	SHQ1-like_CS	UniProtKB/TrEMBL
PhenoGen	Shq1	PhenoGen
PROSITE	PS51203	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000005433	RatGTEx
Superfamily-SCOP	HSP20_chap	UniProtKB/TrEMBL
UniProt	A6IBH9	ENTREZGENE, UniProtKB/TrEMBL
	B4F784	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-01-23	Shq1	SHQ1, H/ACA ribonucleoprotein assembly factor	Shq1	SHQ1 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Shq1	SHQ1 homolog (S. cerevisiae)	Shq1_predicted	SHQ1 homolog (S. cerevisiae) (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Shq1_predicted	SHQ1 homolog (S. cerevisiae) (predicted)	RGD1310610_predicted	similar to hypothetical protein FLJ10539 (predicted)	Symbol and Name updated	1299863	APPROVED
2005-01-20	RGD1310610_predicted	similar to hypothetical protein FLJ10539 (predicted)	LOC297483_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC297483_predicted	similar to hypothetical protein FLJ10539 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM