Advanced Search (OLGA)

Gene: Fa2h (fatty acid 2-hydroxylase) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Fa2h

Name:

fatty acid 2-hydroxylase

RGD ID:

1310347

Description:

Enables fatty acid 2-hydroxylase activity. Involved in galactosylceramide biosynthetic process. Predicted to be located in membrane. Predicted to be active in endoplasmic reticulum. Human ortholog(s) of this gene implicated in hereditary spastic paraplegia 35. Orthologous to human FA2H (fatty acid 2-hydroxylase); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

fatty acid alpha-hydroxylase; LOC307855; RGD1310347; similar to RIKEN cDNA 5430401O09 gene; WD repeat domain 59; Wdr59

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FA2H (fatty acid 2-hydroxylase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Fa2h (fatty acid 2-hydroxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fa2h (fatty acid 2-hydroxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FA2H (fatty acid 2-hydroxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FA2H (fatty acid 2-hydroxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fa2h (fatty acid 2-hydroxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FA2H (fatty acid 2-hydroxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FA2H (fatty acid 2-hydroxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fa2h (fatty acid 2-hydroxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	DNAJC3 (DnaJ heat shock protein family (Hsp40) member C3)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	FA2H (fatty acid 2-hydroxylase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fa2h (fatty acid 2-hydroxylase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fa2h (fatty acid 2-hydroxylase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SCS7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	fa2h	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	fath-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	fa2h	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	56,222,240 - 56,273,480 (-)	NCBI		GRCr8
mRatBN7.2	19	39,312,904 - 39,364,153 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	39,312,906 - 39,364,153 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	46,117,440 - 46,168,745 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	46,770,768 - 46,822,076 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	49,070,937 - 49,122,203 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	43,545,380 - 43,596,788 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	43,545,378 - 43,596,801 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	54,355,770 - 54,407,097 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	41,268,120 - 41,319,682 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	41,275,527 - 41,460,325 (-)	NCBI
Celera	19	38,700,320 - 38,749,569 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fa2h	Rat	genetic disease		ISO	FA2H (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:17576681 more ...
Fa2h	Rat	hereditary spastic paraplegia		ISO	FA2H (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary spastic paraplegia	ClinVar	PMID:18414213 more ...
Fa2h	Rat	hereditary spastic paraplegia		ISO	FA2H (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:18414213 more ...
Fa2h	Rat	hereditary spastic paraplegia 35		ISO	FA2H (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:16199547 more ...
Fa2h	Rat	macular corneal dystrophy		ISO	FA2H (Homo sapiens)	8554872	ClinVar Annotator: match by term: Macular corneal dystrophy	ClinVar	PMID:11017086 more ...
Fa2h	Rat	neurodegeneration with brain iron accumulation		ISO	FA2H (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodegeneration with brain iron accumulation	ClinVar	PMID:20853438 more ...
Fa2h	Rat	Neurodevelopmental Disorders		ISO	FA2H (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
Fa2h	Rat	paraplegia		ISO	FA2H (Homo sapiens)	8554872	ClinVar Annotator: match by term: Spastic paraplegia	ClinVar	PMID:16199547 more ...
Fa2h	Rat	spastic ataxia		ISO	FA2H (Homo sapiens)	8554872	ClinVar Annotator: match by term: Spastic ataxia	ClinVar	PMID:25741868 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fa2h	Rat	hereditary spastic paraplegia 35		ISS	Fa2h (Mus musculus)	13592920	OMIM:612319	MouseDO

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fa2h	Rat	hereditary spastic paraplegia 35		ISO	FA2H (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fa2h	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Fa2h (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of FA2H mRNA	CTD	PMID:22206623
Fa2h	Rat	17beta-estradiol	multiple interactions	ISO	FA2H (Homo sapiens)	6480464	[Estradiol co-treated with TGFB1 protein] results in decreased expression of FA2H mRNA	CTD	PMID:30165855
Fa2h	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	FA2H (Homo sapiens)	6480464	Tetrachlorodibenzodioxin results in decreased expression of FA2H mRNA	CTD	PMID:21998131
Fa2h	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of FA2H mRNA	CTD	PMID:33387578
Fa2h	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Fa2h (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of FA2H mRNA	CTD	PMID:28213091
Fa2h	Rat	2-hydroxypropanoic acid	decreases expression	ISO	FA2H (Homo sapiens)	6480464	Lactic Acid results in decreased expression of FA2H mRNA	CTD	PMID:30851411
Fa2h	Rat	3,4-methylenedioxymethamphetamine	increases expression	ISO	Fa2h (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of FA2H mRNA	CTD	PMID:20188158
Fa2h	Rat	3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid	multiple interactions	ISO	FA2H (Homo sapiens)	6480464	MK-886 inhibits the reaction [Dronabinol results in increased expression of FA2H mRNA] and MK-886 promotes the reaction [Dronabinol results in increased expression of FA2H mRNA]	CTD	PMID:23535410 and PMID:25291031
Fa2h	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of FA2H mRNA	CTD	PMID:24780913 more ...
Fa2h	Rat	afimoxifene	multiple interactions	ISO	FA2H (Homo sapiens)	6480464	afimoxifene inhibits the reaction [Estrogens results in decreased expression of FA2H mRNA]	CTD	PMID:21233418
Fa2h	Rat	aflatoxin B1	increases expression	ISO	Fa2h (Mus musculus)	6480464	Aflatoxin B1 results in increased expression of FA2H mRNA	CTD	PMID:19770486
Fa2h	Rat	all-trans-retinoic acid	decreases expression	ISO	FA2H (Homo sapiens)	6480464	Tretinoin results in decreased expression of FA2H mRNA	CTD	PMID:23830798
Fa2h	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in increased expression of FA2H mRNA	CTD	PMID:35163327
Fa2h	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of FA2H mRNA	CTD	PMID:30047161 and PMID:38685447
Fa2h	Rat	antirheumatic drug	decreases expression	ISO	FA2H (Homo sapiens)	6480464	Antirheumatic Agents results in decreased expression of FA2H mRNA	CTD	PMID:24449571
Fa2h	Rat	arsenous acid	decreases response to substance	ISO	FA2H (Homo sapiens)	6480464	FA2H protein results in decreased susceptibility to Arsenic Trioxide	CTD	PMID:20707922
Fa2h	Rat	arsenous acid	decreases expression	ISO	FA2H (Homo sapiens)	6480464	Arsenic Trioxide results in decreased expression of FA2H mRNA	CTD	PMID:19128835
Fa2h	Rat	atrazine	increases expression	ISO	FA2H (Homo sapiens)	6480464	Atrazine results in increased expression of FA2H mRNA	CTD	PMID:22378314
Fa2h	Rat	benzo[a]pyrene	multiple interactions	ISO	Fa2h (Mus musculus)	6480464	AHR protein affects the reaction [Benzo(a)pyrene affects the expression of FA2H mRNA]	CTD	PMID:22228805
Fa2h	Rat	benzo[a]pyrene	increases methylation	ISO	Fa2h (Mus musculus)	6480464	Benzo(a)pyrene results in increased methylation of FA2H intron	CTD	PMID:27901495
Fa2h	Rat	benzo[a]pyrene	increases expression	ISO	Fa2h (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of FA2H mRNA	CTD	PMID:22228805
Fa2h	Rat	benzo[a]pyrene	decreases expression	ISO	Fa2h (Mus musculus)	6480464	Benzo(a)pyrene results in decreased expression of FA2H mRNA	CTD	PMID:22228805
Fa2h	Rat	beta-lapachone	increases expression	ISO	FA2H (Homo sapiens)	6480464	beta-lapachone results in increased expression of FA2H mRNA	CTD	PMID:38218311
Fa2h	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of FA2H mRNA	CTD	PMID:25181051
Fa2h	Rat	bisphenol A	increases expression	ISO	Fa2h (Mus musculus)	6480464	bisphenol A results in increased expression of FA2H mRNA	CTD	PMID:32156529
Fa2h	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of FA2H mRNA	CTD	PMID:30816183 and PMID:32528016
Fa2h	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of FA2H gene	CTD	PMID:28505145
Fa2h	Rat	bisphenol F	increases expression	ISO	Fa2h (Mus musculus)	6480464	bisphenol F results in increased expression of FA2H mRNA	CTD	PMID:36706583
Fa2h	Rat	butanal	increases expression	ISO	FA2H (Homo sapiens)	6480464	butyraldehyde results in increased expression of FA2H mRNA	CTD	PMID:26079696
Fa2h	Rat	choline	multiple interactions	ISO	Fa2h (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of and results in increased expression of FA2H more ...	CTD	PMID:20938992
Fa2h	Rat	copper atom	multiple interactions	ISO	FA2H (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in increased expression of FA2H mRNA	CTD	PMID:20971185
Fa2h	Rat	copper(0)	multiple interactions	ISO	FA2H (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in increased expression of FA2H mRNA	CTD	PMID:20971185
Fa2h	Rat	copper(II) sulfate	increases expression	ISO	FA2H (Homo sapiens)	6480464	Copper Sulfate results in increased expression of FA2H mRNA	CTD	PMID:19549813
Fa2h	Rat	crocidolite asbestos	increases expression	ISO	FA2H (Homo sapiens)	6480464	Asbestos and Crocidolite results in increased expression of FA2H mRNA	CTD	PMID:18687144
Fa2h	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of FA2H mRNA	CTD	PMID:26577399 and PMID:27523638
Fa2h	Rat	cyclosporin A	increases expression	ISO	Fa2h (Mus musculus)	6480464	Cyclosporine results in increased expression of FA2H mRNA	CTD	PMID:19770486
Fa2h	Rat	diarsenic trioxide	decreases expression	ISO	FA2H (Homo sapiens)	6480464	Arsenic Trioxide results in decreased expression of FA2H mRNA	CTD	PMID:19128835
Fa2h	Rat	diarsenic trioxide	decreases response to substance	ISO	FA2H (Homo sapiens)	6480464	FA2H protein results in decreased susceptibility to Arsenic Trioxide	CTD	PMID:20707922
Fa2h	Rat	dimethylarsinous acid	increases expression	ISO	FA2H (Homo sapiens)	6480464	dimethylarsinous acid results in increased expression of FA2H mRNA	CTD	PMID:23487506
Fa2h	Rat	dorsomorphin	multiple interactions	ISO	FA2H (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FA2H mRNA	CTD	PMID:27188386
Fa2h	Rat	entinostat	multiple interactions	ISO	FA2H (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FA2H mRNA	CTD	PMID:27188386
Fa2h	Rat	entinostat	increases expression	ISO	FA2H (Homo sapiens)	6480464	entinostat results in increased expression of FA2H mRNA	CTD	PMID:26272509
Fa2h	Rat	ethanol	affects splicing	ISO	Fa2h (Mus musculus)	6480464	Ethanol affects the splicing of FA2H mRNA	CTD	PMID:30319688
Fa2h	Rat	folic acid	multiple interactions	ISO	Fa2h (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of and results in increased expression of FA2H more ...	CTD	PMID:20938992
Fa2h	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of FA2H mRNA	CTD	PMID:33387578
Fa2h	Rat	GW 4064	decreases expression	ISO	Fa2h (Mus musculus)	6480464	GW 4064 results in decreased expression of FA2H mRNA	CTD	PMID:26655953
Fa2h	Rat	GW 7647	increases expression	ISO	FA2H (Homo sapiens)	6480464	GW 7647 results in increased expression of FA2H mRNA	CTD	PMID:23535410
Fa2h	Rat	isotretinoin	decreases expression	ISO	FA2H (Homo sapiens)	6480464	Isotretinoin results in decreased expression of FA2H mRNA	CTD	PMID:20436886
Fa2h	Rat	L-methionine	multiple interactions	ISO	Fa2h (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of and results in increased expression of FA2H more ...	CTD	PMID:20938992
Fa2h	Rat	lead diacetate	increases expression	ISO	Fa2h (Mus musculus)	6480464	lead acetate results in increased expression of FA2H mRNA	CTD	PMID:20542052
Fa2h	Rat	manganese atom	increases expression	EXP		6480464	Manganese results in increased expression of FA2H mRNA	CTD	PMID:26745496
Fa2h	Rat	manganese(0)	increases expression	EXP		6480464	Manganese results in increased expression of FA2H mRNA	CTD	PMID:26745496
Fa2h	Rat	manganese(II) chloride	increases expression	EXP		6480464	manganese chloride results in increased expression of FA2H mRNA	CTD	PMID:26745496
Fa2h	Rat	manganese(II) chloride	decreases expression	EXP		6480464	manganese chloride results in decreased expression of FA2H mRNA	CTD	PMID:28801915
Fa2h	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of FA2H mRNA	CTD	PMID:30047161
Fa2h	Rat	methotrexate	decreases expression	ISO	FA2H (Homo sapiens)	6480464	Methotrexate results in decreased expression of FA2H mRNA	CTD	PMID:17400583
Fa2h	Rat	methotrexate	increases expression	ISO	FA2H (Homo sapiens)	6480464	Methotrexate results in increased expression of FA2H mRNA	CTD	PMID:24449571
Fa2h	Rat	N-methyl-4-phenylpyridinium	decreases expression	EXP		6480464	1-Methyl-4-phenylpyridinium results in decreased expression of FA2H mRNA	CTD	PMID:28801915
Fa2h	Rat	N-methyl-4-phenylpyridinium	decreases methylation	EXP		6480464	1-Methyl-4-phenylpyridinium results in decreased methylation of FA2H gene	CTD	PMID:28801915
Fa2h	Rat	nickel atom	decreases expression	ISO	FA2H (Homo sapiens)	6480464	Nickel results in decreased expression of FA2H mRNA	CTD	PMID:24768652
Fa2h	Rat	paracetamol	decreases expression	ISO	FA2H (Homo sapiens)	6480464	Acetaminophen results in decreased expression of FA2H mRNA	CTD	PMID:26690555
Fa2h	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of FA2H mRNA	CTD	PMID:33387578
Fa2h	Rat	pentanal	increases expression	ISO	FA2H (Homo sapiens)	6480464	pentanal results in increased expression of FA2H mRNA	CTD	PMID:26079696
Fa2h	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in increased expression of FA2H mRNA	CTD	PMID:35163327
Fa2h	Rat	perfluorooctanoic acid	multiple interactions	ISO	FA2H (Homo sapiens)	6480464	perfluorooctanoic acid inhibits the reaction [PPARD protein inhibits the reaction [PPARA protein results in increased expression of FA2H mRNA]]	CTD	PMID:35370244
Fa2h	Rat	perfluorooctanoic acid	increases expression	ISO	FA2H (Homo sapiens)	6480464	perfluorooctanoic acid results in increased expression of FA2H mRNA and perfluorooctanoic acid results in increased expression of FA2H protein	CTD	PMID:35370244
Fa2h	Rat	phenobarbital	affects expression	ISO	FA2H (Homo sapiens)	6480464	Phenobarbital affects the expression of FA2H mRNA	CTD	PMID:19159669
Fa2h	Rat	pirinixic acid	multiple interactions	ISO	Fa2h (Mus musculus)	6480464	[pirinixic acid co-treated with PPARA] results in increased expression of FA2H mRNA	CTD	PMID:20813756
Fa2h	Rat	pirinixic acid	increases expression	ISO	Fa2h (Mus musculus)	6480464	pirinixic acid results in increased expression of FA2H mRNA	CTD	PMID:20813756
Fa2h	Rat	propanal	increases expression	ISO	FA2H (Homo sapiens)	6480464	propionaldehyde results in increased expression of FA2H mRNA	CTD	PMID:26079696
Fa2h	Rat	rac-lactic acid	decreases expression	ISO	FA2H (Homo sapiens)	6480464	Lactic Acid results in decreased expression of FA2H mRNA	CTD	PMID:30851411
Fa2h	Rat	S-(1,2-dichlorovinyl)-L-cysteine	decreases expression	ISO	FA2H (Homo sapiens)	6480464	S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of FA2H mRNA	CTD	PMID:35811015
Fa2h	Rat	SB 431542	multiple interactions	ISO	FA2H (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FA2H mRNA	CTD	PMID:27188386
Fa2h	Rat	silicon dioxide	increases expression	ISO	FA2H (Homo sapiens)	6480464	Silicon Dioxide analog results in increased expression of FA2H mRNA	CTD	PMID:25895662
Fa2h	Rat	sodium arsenite	increases expression	ISO	FA2H (Homo sapiens)	6480464	sodium arsenite results in increased expression of FA2H mRNA	CTD	PMID:29301061
Fa2h	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of FA2H mRNA	CTD	PMID:30047161
Fa2h	Rat	sulforaphane	decreases expression	ISO	FA2H (Homo sapiens)	6480464	sulforaphane results in decreased expression of FA2H mRNA	CTD	PMID:31838189
Fa2h	Rat	sunitinib	decreases expression	ISO	FA2H (Homo sapiens)	6480464	Sunitinib results in decreased expression of FA2H mRNA	CTD	PMID:31533062
Fa2h	Rat	titanium dioxide	decreases methylation	ISO	Fa2h (Mus musculus)	6480464	titanium dioxide results in decreased methylation of FA2H gene	CTD	PMID:35295148
Fa2h	Rat	triadimefon	decreases expression	EXP		6480464	triadimefon results in decreased expression of FA2H mRNA	CTD	PMID:30047161
Fa2h	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of FA2H mRNA	CTD	PMID:33387578
Fa2h	Rat	trichostatin A	increases expression	ISO	FA2H (Homo sapiens)	6480464	trichostatin A results in increased expression of FA2H mRNA	CTD	PMID:24935251
Fa2h	Rat	triptonide	increases expression	ISO	Fa2h (Mus musculus)	6480464	triptonide results in increased expression of FA2H mRNA	CTD	PMID:33045310
Fa2h	Rat	valproic acid	increases expression	ISO	FA2H (Homo sapiens)	6480464	Valproic Acid results in increased expression of FA2H mRNA	CTD	PMID:24935251
Fa2h	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of FA2H mRNA	CTD	PMID:23034163

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fa2h	Rat	central nervous system myelin maintenance	acts_upstream_of_or_within	ISO	Fa2h (Mus musculus)	1624291	MGI:3829000 more ...	RGD	PMID:18815260 and PMID:21491498
Fa2h	Rat	central nervous system myelin maintenance	acts_upstream_of_or_within	IEA	UniProtKB:Q5MPP0 and ensembl:ENSMUSP00000043597	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fa2h	Rat	ceramide biosynthetic process	involved_in	ISS	UniProtKB:Q7L5A8	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Fa2h	Rat	ceramide biosynthetic process	involved_in	IEA	UniProtKB:Q5MPP0 and ensembl:ENSMUSP00000043597	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fa2h	Rat	ceramide biosynthetic process	involved_in	IEA	UniProtKB:Q7L5A8 and ensembl:ENSP00000219368	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fa2h	Rat	ceramide biosynthetic process	involved_in	ISO	Fa2h (Mus musculus)	1624291	PMID:22517924	RGD	PMID:22517924
Fa2h	Rat	ceramide biosynthetic process	involved_in	ISO	FA2H (Homo sapiens)	1624291	PMID:15337768	RGD	PMID:15337768
Fa2h	Rat	ceramide biosynthetic process	involved_in	ISS	UniProtKB:Q5MPP0	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Fa2h	Rat	establishment of skin barrier	involved_in	ISO	FA2H (Homo sapiens)	1624291	PMID:17355976	RGD	PMID:17355976
Fa2h	Rat	establishment of skin barrier	involved_in	IEA	UniProtKB:Q7L5A8 and ensembl:ENSP00000219368	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fa2h	Rat	establishment of skin barrier	involved_in	ISS	UniProtKB:Q7L5A8	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Fa2h	Rat	fatty acid biosynthetic process	involved_in	IEA	UniProtKB-KW:KW-0275	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fa2h	Rat	fatty acid metabolic process	involved_in	IBA	MGI:2443327 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fa2h	Rat	fatty acid metabolic process	involved_in	IEA	UniPathway:UPA00199	1600115	GO_REF:0000041	UniProt	GO_REF:0000041
Fa2h	Rat	fatty acid metabolic process	acts_upstream_of_or_within	IEA	UniProtKB:Q5MPP0 and ensembl:ENSMUSP00000043597	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fa2h	Rat	fatty acid metabolic process	acts_upstream_of_or_within	ISO	Fa2h (Mus musculus)	1624291	PMID:16998236	RGD	PMID:16998236
Fa2h	Rat	fatty acid metabolic process	involved_in	IEA	UniProtKB-KW:KW-0276	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fa2h	Rat	galactosylceramide biosynthetic process	involved_in	IMP		13825191	PMID:17901466	UniProt
Fa2h	Rat	galactosylceramide biosynthetic process	involved_in	IEA	UniProtKB:Q5MPP0 and ensembl:ENSMUSP00000043597	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fa2h	Rat	galactosylceramide biosynthetic process	involved_in	ISO	Fa2h (Mus musculus)	1624291	PMID:15658937 and PMID:18815260	RGD	PMID:15658937 and PMID:18815260
Fa2h	Rat	galactosylceramide biosynthetic process	involved_in	IEA	UniPathway:UPA00787	1600115	GO_REF:0000041	UniProt	GO_REF:0000041
Fa2h	Rat	galactosylceramide biosynthetic process	involved_in	ISS	UniProtKB:Q5MPP0	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Fa2h	Rat	glucosylceramide biosynthetic process	involved_in	ISO	Fa2h (Mus musculus)	1624291	PMID:21628453	RGD	PMID:21628453
Fa2h	Rat	glucosylceramide biosynthetic process	involved_in	IEA	UniProtKB:Q5MPP0 and ensembl:ENSMUSP00000043597	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fa2h	Rat	glucosylceramide biosynthetic process	involved_in	ISS	UniProtKB:Q5MPP0	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Fa2h	Rat	lipid biosynthetic process	involved_in	IEA	InterPro:IPR006694	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Fa2h	Rat	lipid metabolic process	involved_in	IEA	InterPro:IPR014430	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Fa2h	Rat	lipid metabolic process	involved_in	IEA	ARBA:ARBA00028591	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Fa2h	Rat	lipid metabolic process	involved_in	IEA	UniProtKB-KW:KW-0443	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fa2h	Rat	lipid modification	acts_upstream_of_or_within	ISO	Fa2h (Mus musculus)	1624291	MGI:3829000 PMID:15658937 and PMID:18815260	RGD	PMID:15658937 and PMID:18815260
Fa2h	Rat	lipid modification	acts_upstream_of_or_within	IEA	UniProtKB:Q5MPP0 and ensembl:ENSMUSP00000043597	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fa2h	Rat	peripheral nervous system myelin maintenance	acts_upstream_of_or_within	ISO	Fa2h (Mus musculus)	1624291	MGI:3829000 PMID:18815260	RGD	PMID:18815260
Fa2h	Rat	peripheral nervous system myelin maintenance	acts_upstream_of_or_within	IEA	UniProtKB:Q5MPP0 and ensembl:ENSMUSP00000043597	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fa2h	Rat	plasma membrane raft organization	involved_in	ISS	UniProtKB:Q5MPP0	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Fa2h	Rat	plasma membrane raft organization	involved_in	ISO	Fa2h (Mus musculus)	1624291	PMID:22517924	RGD	PMID:22517924
Fa2h	Rat	plasma membrane raft organization	involved_in	IEA	UniProtKB:Q5MPP0 and ensembl:ENSMUSP00000043597	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fa2h	Rat	regulation of acinar cell proliferation	acts_upstream_of_or_within	IEA	UniProtKB:Q5MPP0 and ensembl:ENSMUSP00000043597	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fa2h	Rat	regulation of acinar cell proliferation	acts_upstream_of_or_within	ISO	Fa2h (Mus musculus)	1624291	MGI:3829000 PMID:21628453	RGD	PMID:21628453
Fa2h	Rat	regulation of hair cycle	acts_upstream_of_or_within	ISO	Fa2h (Mus musculus)	1624291	MGI:3829000 PMID:21628453	RGD	PMID:21628453
Fa2h	Rat	regulation of hair cycle	acts_upstream_of_or_within	IEA	UniProtKB:Q5MPP0 and ensembl:ENSMUSP00000043597	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fa2h	Rat	regulation of sebum secreting cell proliferation	acts_upstream_of_or_within	ISO	Fa2h (Mus musculus)	1624291	MGI:3829000 PMID:21628453	RGD	PMID:21628453
Fa2h	Rat	regulation of sebum secreting cell proliferation	acts_upstream_of_or_within	IEA	UniProtKB:Q5MPP0 and ensembl:ENSMUSP00000043597	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fa2h	Rat	sebaceous gland cell differentiation	acts_upstream_of_or_within	IEA	UniProtKB:Q5MPP0 and ensembl:ENSMUSP00000043597	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fa2h	Rat	sebaceous gland cell differentiation	acts_upstream_of_or_within	ISO	Fa2h (Mus musculus)	1624291	MGI:3829000 PMID:21628453	RGD	PMID:21628453
Fa2h	Rat	sphingolipid metabolic process	involved_in	IEA	UniProtKB-KW:KW-0746	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fa2h	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fa2h	Rat	endoplasmic reticulum	located_in	ISO	Fa2h (Mus musculus)	1624291	PMID:15658937	RGD	PMID:15658937
Fa2h	Rat	endoplasmic reticulum	is_active_in	IBA	MGI:2443327 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fa2h	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB:Q5MPP0 and ensembl:ENSMUSP00000043597	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fa2h	Rat	endoplasmic reticulum membrane	located_in	IEA	UniProtKB-SubCell:SL-0097	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Fa2h	Rat	intracellular membrane-bounded organelle	located_in	IEA	UniProtKB-KW:KW-0492	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fa2h	Rat	membrane	located_in	ISS	UniProtKB:Q7L5A8	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Fa2h	Rat	membrane	located_in	IEA	InterPro:IPR014430	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Fa2h	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fa2h	Rat	membrane	located_in	IEA	UniProtKB:Q7L5A8 and ensembl:ENSP00000219368	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fa2h	Rat	membrane	located_in	ISO	FA2H (Homo sapiens)	1624291	PMID:15337768	RGD	PMID:15337768

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fa2h	Rat	4-hydroxysphinganine ceramide fatty acyl 2-hydroxylase activity	enables	ISO	FA2H (Homo sapiens)	1624291	PMID:22517924	RGD	PMID:22517924
Fa2h	Rat	4-hydroxysphinganine ceramide fatty acyl 2-hydroxylase activity	enables	IEA	UniProtKB:Q7L5A8 and ensembl:ENSP00000219368	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fa2h	Rat	fatty acid 2-hydroxylase activity	enables	ISS	UniProtKB:Q7L5A8	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Fa2h	Rat	fatty acid 2-hydroxylase activity	enables	IEA	UniProtKB:Q5MPP0 and ensembl:ENSMUSP00000043597	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fa2h	Rat	fatty acid 2-hydroxylase activity	enables	ISO	Fa2h (Mus musculus)	1624291	PMID:15658937 and PMID:16998236	RGD	PMID:15658937 and PMID:16998236
Fa2h	Rat	fatty acid 2-hydroxylase activity	enables	IBA	FB:FBgn0050502 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fa2h	Rat	fatty acid 2-hydroxylase activity	enables	IEA	UniProtKB:Q7L5A8 and ensembl:ENSP00000219368	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fa2h	Rat	fatty acid 2-hydroxylase activity	enables	IEA	InterPro:IPR014430	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Fa2h	Rat	fatty acid 2-hydroxylase activity	enables	ISO	FA2H (Homo sapiens)	1624291	PMID:15337768 more ...	RGD	PMID:15337768 more ...
Fa2h	Rat	fatty acid 2-hydroxylase activity	enables	IMP		13825191	PMID:17901466	UniProt
Fa2h	Rat	free fatty acid 2-hydroxylase activity	enables	ISO	FA2H (Homo sapiens)	1624291	PMID:15337768	RGD	PMID:15337768
Fa2h	Rat	free fatty acid 2-hydroxylase activity	enables	IEA	RHEA:38855	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Fa2h	Rat	free fatty acid 2-hydroxylase activity	enables	IEA	UniProtKB:Q7L5A8 and ensembl:ENSP00000219368	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fa2h	Rat	heme binding	enables	IEA	InterPro:IPR018506	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Fa2h	Rat	iron ion binding	enables	IEA	InterPro:IPR006694	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Fa2h	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fa2h	Rat	oxidoreductase activity	enables	IEA	UniProtKB-KW:KW-0560	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fa2h	Rat	oxidoreductase activity	enables	IEA	InterPro:IPR006694	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Fa2h	Rat	protein binding	enables	ISO	FA2H (Homo sapiens)	1624291	UniProtKB:O00623 more ...	RGD	PMID:25416956 more ...

BioCyc Pathways

ceramide degradation by alpha-oxidation

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	FA2H is responsible for the formation of 2-hydroxy galactolipids in peripheral nervous system myelin.	Maldonado EN, etal., J Lipid Res. 2008 Jan;49(1):153-61. doi: 10.1194/jlr.M700400-JLR200. Epub 2007 Sep 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:8889548	PMID:15337768	PMID:15489334	PMID:15658937	PMID:15863841	PMID:16998236	PMID:17355976	PMID:18815260	PMID:21491498	PMID:21628453	PMID:22517924

Fa2h
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	56,222,240 - 56,273,480 (-)	NCBI		GRCr8
mRatBN7.2	19	39,312,904 - 39,364,153 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	39,312,906 - 39,364,153 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	46,117,440 - 46,168,745 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	46,770,768 - 46,822,076 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	49,070,937 - 49,122,203 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	43,545,380 - 43,596,788 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	43,545,378 - 43,596,801 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	54,355,770 - 54,407,097 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	41,268,120 - 41,319,682 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	41,275,527 - 41,460,325 (-)	NCBI
Celera	19	38,700,320 - 38,749,569 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

FA2H
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	74,712,969 - 74,774,820 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	74,712,955 - 74,774,831 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	74,746,867 - 74,808,718 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	73,304,359 - 73,366,224 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	73,304,358 - 73,366,222	NCBI
Celera	16	59,039,540 - 59,101,413 (-)	NCBI		Celera
Cytogenetic Map	16	q23.1	NCBI
HuRef	16	60,496,759 - 60,558,638 (-)	NCBI		HuRef
CHM1_1	16	76,159,142 - 76,220,992 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	80,759,709 - 80,821,550 (-)	NCBI		T2T-CHM13v2.0

Fa2h
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	112,071,770 - 112,120,453 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	112,071,767 - 112,120,456 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	111,345,138 - 111,393,821 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	111,345,135 - 111,393,824 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	113,869,038 - 113,917,721 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	114,231,814 - 114,280,488 (-)	NCBI		MGSCv36	mm8
Celera	8	115,571,613 - 115,620,271 (-)	NCBI		Celera
Cytogenetic Map	8	E1	NCBI
cM Map	8	57.98	NCBI

Fa2h
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955484	2,726,362 - 2,775,903 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955484	2,726,496 - 2,775,763 (+)	NCBI	ChiLan1.0	ChiLan1.0

FA2H
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	84,427,208 - 84,488,814 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	90,349,280 - 90,410,924 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	55,278,769 - 55,340,332 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	74,632,161 - 74,693,710 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	74,632,179 - 74,693,710 (-)	Ensembl	panpan1.1		panPan2

FA2H
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	75,878,539 - 75,923,886 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	75,878,243 - 75,948,094 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	75,854,248 - 75,930,177 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	76,234,701 - 76,310,974 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	76,234,701 - 76,304,198 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	76,137,818 - 76,213,734 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	75,960,777 - 76,036,528 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	76,452,798 - 76,528,826 (+)	NCBI		UU_Cfam_GSD_1.0

Fa2h
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	35,913,903 - 35,964,152 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	23,624,969 - 23,675,235 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936475	23,625,023 - 23,675,211 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FA2H
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	12,855,421 - 12,910,818 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	12,855,330 - 12,910,821 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	12,797,906 - 12,853,541 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FA2H
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	52,930,289 - 52,993,751 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	52,930,833 - 52,992,499 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	15,810,775 - 15,873,476 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fa2h
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	12,125,506 - 12,186,671 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624746	12,125,709 - 12,186,254 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Fa2h
305 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	511
Count of miRNA genes:	244
Interacting mature miRNAs:	290
Transcripts:	ENSRNOT00000025625
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61350	Bp32	Blood pressure QTL 32		0.012	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	19	20483575	57337602	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	29322490	57337602	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	19	33838214	55283146	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	7457249	42983518	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10827970	43544039	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	15605023	46559041	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat
1549835	Tcas7	Tongue tumor susceptibility QTL 7		0.001	tongue integrity trait (VT:0010553)	squamous cell carcinoma of the head and neck tumor number (CMO:0001876)	19	24817978	39654489	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
724565	Tcas5	Tongue tumor susceptibility QTL 5	10.04		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	19	9977753	39654489	Rat

D19Rat69

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	19	56,258,204 - 56,258,405 (+)	Marker Load Pipeline
mRatBN7.2	19	39,348,870 - 39,349,071 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	43,581,528 - 43,581,728	NCBI	Rnor6.0
Rnor_5.0	19	54,391,918 - 54,392,118	UniSTS	Rnor5.0
RGSC_v3.4	19	41,304,016 - 41,304,337	RGD	RGSC3.4
RGSC_v3.4	19	41,304,084 - 41,304,284	UniSTS	RGSC3.4
RGSC_v3.1	19	41,308,965 - 41,309,165	RGD
Celera	19	38,734,265 - 38,734,461	UniSTS
RH 3.4 Map	19	483.9	UniSTS
RH 3.4 Map	19	483.9	RGD
RH 2.0 Map	19	540.3	RGD
SHRSP x BN Map	19	28.8998	RGD
Cytogenetic Map	19	q12	UniSTS

RH144444

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	39,313,287 - 39,313,528 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	43,545,764 - 43,546,004	NCBI	Rnor6.0
Rnor_5.0	19	54,356,154 - 54,356,394	UniSTS	Rnor5.0
RGSC_v3.4	19	41,268,504 - 41,268,744	UniSTS	RGSC3.4
Celera	19	38,700,704 - 38,700,944	UniSTS
RH 3.4 Map	19	485.8	UniSTS
Cytogenetic Map	19	q12	UniSTS

BE110252

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	39,320,478 - 39,320,636 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	43,552,955 - 43,553,112	NCBI	Rnor6.0
Rnor_5.0	19	54,363,345 - 54,363,502	UniSTS	Rnor5.0
RGSC_v3.4	19	41,275,695 - 41,275,852	UniSTS	RGSC3.4
Celera	19	38,706,365 - 38,706,522	UniSTS
RH 3.4 Map	19	485.4	UniSTS
Cytogenetic Map	19	q12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
8	11	39	93	55	51	27	13	27	6	161	73	74	45	57	24


RefSeq Transcripts	NM_001135583	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BQ201885	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB610350	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CV120060	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ339484	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025625 ⟹ ENSRNOP00000025625

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	39,312,906 - 39,364,153 (-)	Ensembl
Rnor_6.0 Ensembl	19	43,545,378 - 43,596,801 (-)	Ensembl

RefSeq Acc Id:

NM_001135583 ⟹ NP_001129055

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	56,222,240 - 56,273,480 (-)	NCBI
mRatBN7.2	19	39,312,904 - 39,364,153 (-)	NCBI
Rnor_6.0	19	43,545,380 - 43,596,788 (-)	NCBI
Rnor_5.0	19	54,355,770 - 54,407,097 (-)	NCBI
RGSC_v3.4	19	41,268,120 - 41,319,682 (-)	RGD
Celera	19	38,700,320 - 38,749,569 (-)	RGD

Sequence:

show sequence

GTTAGAGGCGCGCTGGGCGGCCGCGGAGCAGACTGCCGGGCTCCGAGATCCGAGCTCCGCTCTCCCGCCATGGCCCCCGCTCCGCCCCCCGCCGCCTCCTTCACGTCCGCCGAGGTCCAGCGGCGCCT
GGCGGCCGGTGCCTGCTGGGTCCGTCGCGGGGCCAGTCTCTACGACCTCACCGGCTTCGTGCGGCATCATCCGGGGGGCGAGCAGCTGCTGCTGGCGCGGGCTGGCCAGGACATCAGTGCCGACCTGG
ATGGGCCACCTCATAAACACTCGGACAACGCTCGCCGCTGGCTGGAGCAGTACTATGTGGGCGAACTGCGAGCGGACCCGCAGGATCCCACAGAGAACGGTGCTGGAGCCCCTGCAGAGACTCAGAAG
ACAGATGCTGCTATTGAGCCACAGTTCAAAGTGGTAGACTGGGACAAGGACCTGGTGGACTGGCAGAAACCTCTCCTGTGGCAGGTGGGCCACTTGGGGGAAAAGTATGATGAGTGGGTTCACCAACC
TGTGGCCAGGCCCATTCGCCTCTTCCACTCAGACCTCATCGAGGCCTTCTCCAAGACTGTCTGGTATAGTGTCCCCATCATCTGGGTGCCCCTGGTGCTGTACCTCAGCTGGTCCTACTACCGAACCC
TCACCCAGGACAACATCCGGCTTTTTGCATCATTCACAAGAGATTATTCACTTGTGGTGCCAGAGTCGGTGTTCATAGGCCTCTTCGTGTTGGGCATGCTTATCTGGACTCTTGTGGAGTACCTCATC
CACCGCTTCCTGTTCCACATGAAGCCCCCCAGCAACAGCCATTACCTCATCATGCTGCATTTTGTCATGCACGGACAGCACCACAAGGCACCCTTTGATGGCTCCCGTCTGGTCTTCCCCCCAGTGCC
AGCCTCTGTAGTGGTGGCCTTCTTCTATGTGTTCCTGCGGCTCATTCTGCCTGAGGCCGTGGCAGGCATCCTCTTTGCTGGGGGTCTTCTGGGCTATGTCCTCTATGACATGACCCATTACTACCTGC
ACTTTGGCTCACCTCACAAGGGCTCCTATCTGTACAACATGAAGGCCCACCATGTCAAGCATCACTTCGAATACCAGAAATCAGGGTTCGGCATCAGCACTAAACTGTGGGATTACTTTTTCCACACC
CTCATTCCAGAGGAAGCCGACCCGAAGATGCAGTGACAACCCCTAGACCCTCTGTTCTGCCCTCGGTCCATCCCCAGCCCCTACTCCTGTCCTACCCCCACCTCCACCCGGACCTGCTGAAGTCAGGT
TGGCCAGGCAGGATGGGCTCTGTCTAGCCCTGGGGCTTGGTGGAGACCTGAAAGCAGGACCTCCCTTCTGGCTTACTGTGTGAGGATAGCATCCTCTGGATAGCCAAGTGGCCCTTGAGGACTGGCTC
ATTCCCAAAGAATGATGACCTCCCCATTGGCGTTCCTGCCTACACTTCAGCCCTCAGTGCTATTTTAGGGTCCAGATAATGGTCCCAAGGGGCATGAAGGAAACTGACCCCACCTGTGCCTTAGAACC
CTGGGCTCCCGGGGAGCTTCTCCGATGCAGCAGAGGGACCAGTGTCACAGCAGAAGCATGGCGTGCAGGCCTGTGGCCACGTCGTACTCTCCTGCCCTTTCTTGAAAGAGTTTGATGGTTCAGAAGTA
AATGAAGGGCTTTTCCAAGAAGAGGCAGAATGATGCCTCCCACAGGCCATTCCCAGACCCCAGGACAGCCATTCTGGGCCTTGCCAACCCCAGATACCAGCTATACTGTCAGCTGCCTCAGCGGAAGT
AATCCAGCATTCATCTACCTGGGCAGAGCATGGCGGTGGGTGGCATCCTCTACAAGGCTGACAGGAGCCCTGGCCCTTGTCTTTGGGAATCAACAGAGGCTTTCTCTGTCTCCCCTCTCCCCCAAACC
ACAAAACTGCTCCCCAACAGAGGCTGGAGAAGTCTGTGTTGGTAAGGGCCCCACCCTAGCCCCGGCCATATTGACCTCCACCTGCACAGGTAGAAATCTGCCCCACTCAGGACCCTCCCAGCAGTGCC
TCCTGAAGCCAAGAAGGGGCTTTTATGTGGTGCCTTATTACCCTCCCCTCCTCCTAGACCGTTCTTCCTCATAACCACAGCCCTCACTGCTCCCGAGTCTTATTTATAAACTACATAAATATTCTTAA
TCTGGCCCCAAATGAAGTAGCTGGTCAGATGGTCCTTTCTAATCCTATGTATTGAGCTTATGTAAAAAAAAAAGAAAAATCATCTTGCCTTCCTTTTTGTTCCTTTCTTACCCACAAGCGATTACTAC
TTGAAACTTGTCAAAAACCCAATGGGTGCAAAGACTAAAGAGAGGCAGTGTGACCAGTCTATGATTTGTACTGTTTACGGTGAAGCTATCTAGAGATTTTGGGATAAATATACAAAACTGCAGTTGTG
AAATAAAGATGTAAATAAATTGTATATTTTGAAAAATAAAACATTGAGAAGAAACCAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001129055	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	ABC71132	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025625
	ENSRNOP00000025625.5
GenBank Protein	Q2LAM0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001129055 ⟸ NM_001135583

- UniProtKB:

Q2LAM0 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MAPAPPPAASFTSAEVQRRLAAGACWVRRGASLYDLTGFVRHHPGGEQLLLARAGQDISADLDGPPHKHSDNARRWLEQYYVGELRADPQDPTENGAGAPAETQKTDAAIEPQFKVVDWDKDLVDWQK
PLLWQVGHLGEKYDEWVHQPVARPIRLFHSDLIEAFSKTVWYSVPIIWVPLVLYLSWSYYRTLTQDNIRLFASFTRDYSLVVPESVFIGLFVLGMLIWTLVEYLIHRFLFHMKPPSNSHYLIMLHFVM
HGQHHKAPFDGSRLVFPPVPASVVVAFFYVFLRLILPEAVAGILFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYNMKAHHVKHHFEYQKSGFGISTKLWDYFFHTLIPEEADPKMQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000025625 ⟸ ENSRNOT00000025625

Protein Domains

Cytochrome b5 heme-binding Fatty acid hydroxylase

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q2LAM0-F1-model_v2	AlphaFold	Q2LAM0	1-372	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13701147

Promoter ID:

EPDNEW_R11671

Type:

initiation region

Name:

Fa2h_1

Description:

fatty acid 2-hydroxylase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	43,596,785 - 43,596,845	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-5653	BioCyc
BioCyc Pathway	PWY66-388 [ceramide degradation by alpha-oxidation]	BioCyc
BioCyc Pathway Image	PWY66-388	BioCyc
Ensembl Genes	ENSRNOG00000018950	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000025625	ENTREZGENE
	ENSRNOT00000025625.7	UniProtKB/Swiss-Prot
Gene3D-CATH	3.10.120.10	UniProtKB/Swiss-Prot
InterPro	Cyt_B5-like_heme/steroid-bd	UniProtKB/Swiss-Prot
	Cyt_B5-like_heme/steroid_sf	UniProtKB/Swiss-Prot
	Cyt_B5_heme-BS	UniProtKB/Swiss-Prot
	Fatty_acid_hydroxylase	UniProtKB/Swiss-Prot
	Scs7	UniProtKB/Swiss-Prot
KEGG Report	rno:307855	UniProtKB/Swiss-Prot
NCBI Gene	307855	ENTREZGENE
PANTHER	FATTY ACID 2-HYDROXYLASE	UniProtKB/Swiss-Prot
	PTHR12863	UniProtKB/Swiss-Prot
Pfam	Cyt-b5	UniProtKB/Swiss-Prot
	FA_hydroxylase	UniProtKB/Swiss-Prot
PhenoGen	Fa2h	PhenoGen
PIRSF	IPC-B_HD	UniProtKB/Swiss-Prot
PRINTS	CYTOCHROMEB5	UniProtKB/Swiss-Prot
PROSITE	CYTOCHROME_B5_1	UniProtKB/Swiss-Prot
	CYTOCHROME_B5_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000018950	RatGTEx
SMART	Cyt-b5	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF55856	UniProtKB/Swiss-Prot
UniProt	FA2H_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-05-24	Fa2h	fatty acid 2-hydroxylase	LOC688373	similar to fatty acid 2-hydroxylase	Data merged from RGD:1590002	1643240	APPROVED
2007-12-12	Fa2h	fatty acid 2-hydroxylase	Wdr59	WD repeat domain 59	Symbol and Name updated to reflect Human and Mouse nomenclature	1299863	APPROVED
2006-11-20	LOC688373	similar to fatty acid 2-hydroxylase			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-03-30	Wdr59	WD repeat domain 59	RGD1310347	similar to RIKEN cDNA 5430401O09 gene	Symbol and Name updated	1299863	APPROVED
2006-03-07	RGD1310347	similar to RIKEN cDNA 5430401O09 gene	RGD1310347_predicted	similar to RIKEN cDNA 5430401O09 gene (predicted)	Symbol and Name status set to approved	1299863	APPROVED
2005-01-20	RGD1310347_predicted	similar to RIKEN cDNA 5430401O09 gene (predicted)	LOC307855_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC307855_predicted	similar to RIKEN cDNA 5430401O09 gene (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

BioCyc Pathways