Fa2h (fatty acid 2-hydroxylase) - Rat Genome Database

Name: Fa2h
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Fa2h (fatty acid 2-hydroxylase) Rattus norvegicus

Analyze

Symbol:

Fa2h

Name:

fatty acid 2-hydroxylase

RGD ID:

1310347

Description:

Enables fatty acid alpha-hydroxylase activity. Involved in galactosylceramide biosynthetic process. Predicted to be located in membrane. Predicted to be active in endoplasmic reticulum. Human ortholog(s) of this gene implicated in hereditary spastic paraplegia 35. Orthologous to human FA2H (fatty acid 2-hydroxylase); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

fatty acid alpha-hydroxylase; LOC307855; RGD1310347; similar to RIKEN cDNA 5430401O09 gene; WD repeat domain 59; Wdr59

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FA2H (fatty acid 2-hydroxylase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Fa2h (fatty acid 2-hydroxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fa2h (fatty acid 2-hydroxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FA2H (fatty acid 2-hydroxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FA2H (fatty acid 2-hydroxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fa2h (fatty acid 2-hydroxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FA2H (fatty acid 2-hydroxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FA2H (fatty acid 2-hydroxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fa2h (fatty acid 2-hydroxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	DNAJC3 (DnaJ heat shock protein family (Hsp40) member C3)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	FA2H (fatty acid 2-hydroxylase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fa2h (fatty acid 2-hydroxylase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fa2h (fatty acid 2-hydroxylase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SCS7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	fa2h	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	fath-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	fa2h	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	19	39,312,904 - 39,364,153 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	39,312,906 - 39,364,153 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	46,117,440 - 46,168,745 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	46,770,768 - 46,822,076 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	49,070,937 - 49,122,203 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	43,545,380 - 43,596,788 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	43,545,378 - 43,596,801 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	54,355,770 - 54,407,097 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	41,268,120 - 41,319,682 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	41,275,527 - 41,460,325 (-)	NCBI
Celera	19	38,700,320 - 38,749,569 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

hereditary spastic paraplegia (ISO)

hereditary spastic paraplegia 35 (ISO,ISS)

macular corneal dystrophy (ISO)

neurodegeneration with brain iron accumulation (ISO)

Neurodevelopmental Disorders (ISO)

paraplegia (ISO)

spastic ataxia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid (ISO)

6-propyl-2-thiouracil (EXP)

afimoxifene (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

antirheumatic drug (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

choline (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

dimethylarsinous acid (ISO)

dorsomorphin (ISO)

entinostat (ISO)

ethanol (ISO)

folic acid (ISO)

gentamycin (EXP)

GW 4064 (ISO)

GW 7647 (ISO)

isotretinoin (ISO)

L-methionine (ISO)

lead diacetate (ISO)

manganese atom (EXP)

manganese(0) (EXP)

manganese(II) chloride (EXP)

methimazole (EXP)

methotrexate (ISO)

N-methyl-4-phenylpyridinium (EXP)

nickel atom (ISO)

paracetamol (EXP,ISO)

pentanal (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

propanal (ISO)

rac-lactic acid (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sulforaphane (ISO)

sunitinib (ISO)

triadimefon (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

central nervous system myelin maintenance (ISO)

ceramide biosynthetic process (ISO,ISS)

establishment of skin barrier (ISO,ISS)

fatty acid biosynthetic process (IEA)

fatty acid metabolic process (IBA,ISO)

galactosylceramide biosynthetic process (IEA,IMP,ISO,ISS)

glucosylceramide biosynthetic process (ISO,ISS)

lipid modification (ISO)

peripheral nervous system myelin maintenance (ISO)

plasma membrane raft organization (ISO,ISS)

regulation of acinar cell proliferation (ISO)

regulation of hair cycle (ISO)

regulation of sebum secreting cell proliferation (ISO)

sebaceous gland cell differentiation (ISO)

Cellular Component

endoplasmic reticulum (IBA,ISO)

endoplasmic reticulum membrane (IEA)

membrane (ISO,ISS)

Molecular Function

fatty acid alpha-hydroxylase activity (IBA,IMP,ISO,ISS)

heme binding (IEA)

iron ion binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	FA2H is responsible for the formation of 2-hydroxy galactolipids in peripheral nervous system myelin.	Maldonado EN, etal., J Lipid Res. 2008 Jan;49(1):153-61. doi: 10.1194/jlr.M700400-JLR200. Epub 2007 Sep 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8889548	PMID:15337768	PMID:15489334	PMID:15658937	PMID:15863841	PMID:16998236	PMID:17355976	PMID:18815260	PMID:21491498	PMID:21628453	PMID:22517924

Genomics

Comparative Map Data

Fa2h
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	19	39,312,904 - 39,364,153 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	39,312,906 - 39,364,153 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	46,117,440 - 46,168,745 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	46,770,768 - 46,822,076 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	49,070,937 - 49,122,203 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	43,545,380 - 43,596,788 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	43,545,378 - 43,596,801 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	54,355,770 - 54,407,097 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	41,268,120 - 41,319,682 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	41,275,527 - 41,460,325 (-)	NCBI
Celera	19	38,700,320 - 38,749,569 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

FA2H
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	74,712,969 - 74,774,820 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	74,712,955 - 74,774,831 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	74,746,867 - 74,808,718 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	73,304,359 - 73,366,224 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	73,304,358 - 73,366,222	NCBI
Celera	16	59,039,540 - 59,101,413 (-)	NCBI		Celera
Cytogenetic Map	16	q23.1	NCBI
HuRef	16	60,496,759 - 60,558,638 (-)	NCBI		HuRef
CHM1_1	16	76,159,142 - 76,220,992 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	80,759,709 - 80,821,550 (-)	NCBI		T2T-CHM13v2.0

Fa2h
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	112,071,770 - 112,120,453 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	112,071,767 - 112,120,456 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	111,345,138 - 111,393,821 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	111,345,135 - 111,393,824 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	113,869,038 - 113,917,721 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	114,231,814 - 114,280,488 (-)	NCBI		MGSCv36	mm8
Celera	8	115,571,613 - 115,620,271 (-)	NCBI		Celera
Cytogenetic Map	8	E1	NCBI
cM Map	8	57.98	NCBI

Fa2h
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955484	2,726,362 - 2,775,903 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955484	2,726,496 - 2,775,763 (+)	NCBI	ChiLan1.0	ChiLan1.0

FA2H
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	16	90,349,280 - 90,410,924 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	55,278,769 - 55,340,332 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	74,632,161 - 74,693,710 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	74,632,179 - 74,693,710 (-)	Ensembl	panpan1.1		panPan2

FA2H
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	75,878,539 - 75,923,886 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	75,878,243 - 75,948,094 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	75,854,248 - 75,930,177 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	76,234,701 - 76,310,974 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	76,234,701 - 76,304,198 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	76,137,818 - 76,213,734 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	75,960,777 - 76,036,528 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	76,452,798 - 76,528,826 (+)	NCBI		UU_Cfam_GSD_1.0

Fa2h
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	35,913,903 - 35,964,152 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	23,624,969 - 23,675,235 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936475	23,625,023 - 23,675,211 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FA2H
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	12,855,421 - 12,910,818 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	12,855,330 - 12,910,821 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	12,797,906 - 12,853,541 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FA2H
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	52,930,289 - 52,993,751 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	52,930,833 - 52,992,499 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	15,810,775 - 15,873,476 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fa2h
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	12,125,506 - 12,186,671 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624746	12,125,709 - 12,186,254 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Fa2h
284 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	511
Count of miRNA genes:	244
Interacting mature miRNAs:	290
Transcripts:	ENSRNOT00000025625
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	7457249	42983518	Rat
724565	Tcas5	Tongue tumor susceptibility QTL 5	10.04		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	19	9977753	39654489	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10827970	43544039	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	15605023	46559041	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat
61350	Bp32	Blood pressure QTL 32		0.012	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	19	20483575	57337602	Rat
1549835	Tcas7	Tongue tumor susceptibility QTL 7		0.001	tongue integrity trait (VT:0010553)	squamous cell carcinoma of the head and neck tumor number (CMO:0001876)	19	24817978	39654489	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	29322490	57337602	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum insulin level (CMO:0000358)	19	33838214	55283146	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	19	33838214	55283146	Rat

Markers in Region

D19Rat69

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	39,348,870 - 39,349,071 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	43,581,528 - 43,581,728	NCBI	Rnor6.0
Rnor_5.0	19	54,391,918 - 54,392,118	UniSTS	Rnor5.0
RGSC_v3.4	19	41,304,016 - 41,304,337	RGD	RGSC3.4
RGSC_v3.4	19	41,304,084 - 41,304,284	UniSTS	RGSC3.4
RGSC_v3.1	19	41,308,965 - 41,309,165	RGD
Celera	19	38,734,265 - 38,734,461	UniSTS
RH 3.4 Map	19	483.9	RGD
RH 3.4 Map	19	483.9	UniSTS
RH 2.0 Map	19	540.3	RGD
SHRSP x BN Map	19	28.8998	RGD
Cytogenetic Map	19	q12	UniSTS

RH144444

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	39,313,287 - 39,313,528 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	43,545,764 - 43,546,004	NCBI	Rnor6.0
Rnor_5.0	19	54,356,154 - 54,356,394	UniSTS	Rnor5.0
RGSC_v3.4	19	41,268,504 - 41,268,744	UniSTS	RGSC3.4
Celera	19	38,700,704 - 38,700,944	UniSTS
RH 3.4 Map	19	485.8	UniSTS
Cytogenetic Map	19	q12	UniSTS

BE110252

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	39,320,478 - 39,320,636 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	43,552,955 - 43,553,112	NCBI	Rnor6.0
Rnor_5.0	19	54,363,345 - 54,363,502	UniSTS	Rnor5.0
RGSC_v3.4	19	41,275,695 - 41,275,852	UniSTS	RGSC3.4
Celera	19	38,706,365 - 38,706,522	UniSTS
RH 3.4 Map	19	485.4	UniSTS
Cytogenetic Map	19	q12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2								20	6	7
Low		1	6	6		6	4	4	18	23	14	1	4
Below cutoff		32	20	8	8	8	4	7	18	6	17	8	4

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001135583	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BQ201885	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB610350	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CV120060	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ339484	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000313	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000025625 ⟹ ENSRNOP00000025625

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	39,312,906 - 39,364,153 (-)	Ensembl
Rnor_6.0 Ensembl	19	43,545,378 - 43,596,801 (-)	Ensembl

RefSeq Acc Id:

NM_001135583 ⟹ NP_001129055

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	39,312,904 - 39,364,153 (-)	NCBI
Rnor_6.0	19	43,545,380 - 43,596,788 (-)	NCBI
Rnor_5.0	19	54,355,770 - 54,407,097 (-)	NCBI
RGSC_v3.4	19	41,268,120 - 41,319,682 (-)	RGD
Celera	19	38,700,320 - 38,749,569 (-)	RGD

Sequence:

show sequence

GTTAGAGGCGCGCTGGGCGGCCGCGGAGCAGACTGCCGGGCTCCGAGATCCGAGCTCCGCTCTC
CCGCCATGGCCCCCGCTCCGCCCCCCGCCGCCTCCTTCACGTCCGCCGAGGTCCAGCGGCGCCT
GGCGGCCGGTGCCTGCTGGGTCCGTCGCGGGGCCAGTCTCTACGACCTCACCGGCTTCGTGCGG
CATCATCCGGGGGGCGAGCAGCTGCTGCTGGCGCGGGCTGGCCAGGACATCAGTGCCGACCTGG
ATGGGCCACCTCATAAACACTCGGACAACGCTCGCCGCTGGCTGGAGCAGTACTATGTGGGCGA
ACTGCGAGCGGACCCGCAGGATCCCACAGAGAACGGTGCTGGAGCCCCTGCAGAGACTCAGAAG
ACAGATGCTGCTATTGAGCCACAGTTCAAAGTGGTAGACTGGGACAAGGACCTGGTGGACTGGC
AGAAACCTCTCCTGTGGCAGGTGGGCCACTTGGGGGAAAAGTATGATGAGTGGGTTCACCAACC
TGTGGCCAGGCCCATTCGCCTCTTCCACTCAGACCTCATCGAGGCCTTCTCCAAGACTGTCTGG
TATAGTGTCCCCATCATCTGGGTGCCCCTGGTGCTGTACCTCAGCTGGTCCTACTACCGAACCC
TCACCCAGGACAACATCCGGCTTTTTGCATCATTCACAAGAGATTATTCACTTGTGGTGCCAGA
GTCGGTGTTCATAGGCCTCTTCGTGTTGGGCATGCTTATCTGGACTCTTGTGGAGTACCTCATC
CACCGCTTCCTGTTCCACATGAAGCCCCCCAGCAACAGCCATTACCTCATCATGCTGCATTTTG
TCATGCACGGACAGCACCACAAGGCACCCTTTGATGGCTCCCGTCTGGTCTTCCCCCCAGTGCC
AGCCTCTGTAGTGGTGGCCTTCTTCTATGTGTTCCTGCGGCTCATTCTGCCTGAGGCCGTGGCA
GGCATCCTCTTTGCTGGGGGTCTTCTGGGCTATGTCCTCTATGACATGACCCATTACTACCTGC
ACTTTGGCTCACCTCACAAGGGCTCCTATCTGTACAACATGAAGGCCCACCATGTCAAGCATCA
CTTCGAATACCAGAAATCAGGGTTCGGCATCAGCACTAAACTGTGGGATTACTTTTTCCACACC
CTCATTCCAGAGGAAGCCGACCCGAAGATGCAGTGACAACCCCTAGACCCTCTGTTCTGCCCTC
GGTCCATCCCCAGCCCCTACTCCTGTCCTACCCCCACCTCCACCCGGACCTGCTGAAGTCAGGT
TGGCCAGGCAGGATGGGCTCTGTCTAGCCCTGGGGCTTGGTGGAGACCTGAAAGCAGGACCTCC
CTTCTGGCTTACTGTGTGAGGATAGCATCCTCTGGATAGCCAAGTGGCCCTTGAGGACTGGCTC
ATTCCCAAAGAATGATGACCTCCCCATTGGCGTTCCTGCCTACACTTCAGCCCTCAGTGCTATT
TTAGGGTCCAGATAATGGTCCCAAGGGGCATGAAGGAAACTGACCCCACCTGTGCCTTAGAACC
CTGGGCTCCCGGGGAGCTTCTCCGATGCAGCAGAGGGACCAGTGTCACAGCAGAAGCATGGCGT
GCAGGCCTGTGGCCACGTCGTACTCTCCTGCCCTTTCTTGAAAGAGTTTGATGGTTCAGAAGTA
AATGAAGGGCTTTTCCAAGAAGAGGCAGAATGATGCCTCCCACAGGCCATTCCCAGACCCCAGG
ACAGCCATTCTGGGCCTTGCCAACCCCAGATACCAGCTATACTGTCAGCTGCCTCAGCGGAAGT
AATCCAGCATTCATCTACCTGGGCAGAGCATGGCGGTGGGTGGCATCCTCTACAAGGCTGACAG
GAGCCCTGGCCCTTGTCTTTGGGAATCAACAGAGGCTTTCTCTGTCTCCCCTCTCCCCCAAACC
ACAAAACTGCTCCCCAACAGAGGCTGGAGAAGTCTGTGTTGGTAAGGGCCCCACCCTAGCCCCG
GCCATATTGACCTCCACCTGCACAGGTAGAAATCTGCCCCACTCAGGACCCTCCCAGCAGTGCC
TCCTGAAGCCAAGAAGGGGCTTTTATGTGGTGCCTTATTACCCTCCCCTCCTCCTAGACCGTTC
TTCCTCATAACCACAGCCCTCACTGCTCCCGAGTCTTATTTATAAACTACATAAATATTCTTAA
TCTGGCCCCAAATGAAGTAGCTGGTCAGATGGTCCTTTCTAATCCTATGTATTGAGCTTATGTA
AAAAAAAAAGAAAAATCATCTTGCCTTCCTTTTTGTTCCTTTCTTACCCACAAGCGATTACTAC
TTGAAACTTGTCAAAAACCCAATGGGTGCAAAGACTAAAGAGAGGCAGTGTGACCAGTCTATGA
TTTGTACTGTTTACGGTGAAGCTATCTAGAGATTTTGGGATAAATATACAAAACTGCAGTTGTG
AAATAAAGATGTAAATAAATTGTATATTTTGAAAAATAAAACATTGAGAAGAAACCAAAAAAAA
AAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001129055	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	ABC71132	(Get FASTA)	NCBI Sequence Viewer
	Q2LAM0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001129055 ⟸ NM_001135583

- UniProtKB:

Q2LAM0 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MAPAPPPAASFTSAEVQRRLAAGACWVRRGASLYDLTGFVRHHPGGEQLLLARAGQDISADLDG
PPHKHSDNARRWLEQYYVGELRADPQDPTENGAGAPAETQKTDAAIEPQFKVVDWDKDLVDWQK
PLLWQVGHLGEKYDEWVHQPVARPIRLFHSDLIEAFSKTVWYSVPIIWVPLVLYLSWSYYRTLT
QDNIRLFASFTRDYSLVVPESVFIGLFVLGMLIWTLVEYLIHRFLFHMKPPSNSHYLIMLHFVM
HGQHHKAPFDGSRLVFPPVPASVVVAFFYVFLRLILPEAVAGILFAGGLLGYVLYDMTHYYLHF
GSPHKGSYLYNMKAHHVKHHFEYQKSGFGISTKLWDYFFHTLIPEEADPKMQ

hide sequence

RefSeq Acc Id:

ENSRNOP00000025625 ⟸ ENSRNOT00000025625

Protein Domains

Cytochrome b5 heme-binding Fatty acid hydroxylase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q2LAM0-F1-model_v2	AlphaFold	Q2LAM0	1-372	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310347	AgrOrtholog
BioCyc Gene	G2FUF-5653	BioCyc
BioCyc Pathway	PWY66-388 [ceramide degradation by alpha-oxidation]	BioCyc
Ensembl Genes	ENSRNOG00000018950	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000025625	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000025625	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	3.10.120.10	UniProtKB/Swiss-Prot
InterPro	Cyt_B5-like_heme/steroid-bd	UniProtKB/Swiss-Prot
	Cyt_B5-like_heme/steroid_sf	UniProtKB/Swiss-Prot
	Cyt_B5_heme-BS	UniProtKB/Swiss-Prot
	Fatty_acid_hydroxylase	UniProtKB/Swiss-Prot
	Scs7	UniProtKB/Swiss-Prot
KEGG Report	rno:307855	UniProtKB/Swiss-Prot
NCBI Gene	307855	ENTREZGENE
PANTHER	FATTY ACID 2-HYDROXYLASE	UniProtKB/Swiss-Prot
	PTHR12863	UniProtKB/Swiss-Prot
Pfam	Cyt-b5	UniProtKB/Swiss-Prot
	FA_hydroxylase	UniProtKB/Swiss-Prot
PhenoGen	Fa2h	PhenoGen
PIRSF	IPC-B_HD	UniProtKB/Swiss-Prot
PRINTS	CYTOCHROMEB5	UniProtKB/Swiss-Prot
PROSITE	CYTOCHROME_B5_1	UniProtKB/Swiss-Prot
	CYTOCHROME_B5_2	UniProtKB/Swiss-Prot
SMART	Cyt-b5	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF55856	UniProtKB/Swiss-Prot
UniProt	FA2H_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-05-24	Fa2h	fatty acid 2-hydroxylase	LOC688373	similar to fatty acid 2-hydroxylase	Data Merged	1643240	APPROVED
2007-12-12	Fa2h	fatty acid 2-hydroxylase	Wdr59	WD repeat domain 59	Symbol and Name updated to reflect Human and Mouse nomenclature	1299863	APPROVED
2006-11-20	LOC688373	similar to fatty acid 2-hydroxylase			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-03-30	Wdr59	WD repeat domain 59	RGD1310347	similar to RIKEN cDNA 5430401O09 gene	Symbol and Name updated	1299863	APPROVED
2006-03-07	RGD1310347	similar to RIKEN cDNA 5430401O09 gene	RGD1310347_predicted	similar to RIKEN cDNA 5430401O09 gene (predicted)	Symbol and Name status set to approved	1299863	APPROVED
2005-01-20	RGD1310347_predicted	similar to RIKEN cDNA 5430401O09 gene (predicted)	LOC307855_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC307855_predicted	similar to RIKEN cDNA 5430401O09 gene (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM