Symbol:
Tfg
Name:
trafficking from ER to golgi regulator
RGD ID:
1309751
Description:
Predicted to enable identical protein binding activity. Predicted to be involved in endoplasmic reticulum to Golgi vesicle-mediated transport and positive regulation of canonical NF-kappaB signal transduction. Predicted to be located in cytosol and intracellular membrane-bounded organelle. Predicted to be active in endoplasmic reticulum exit site. Human ortholog(s) of this gene implicated in hereditary spastic paraplegia 57. Orthologous to human TFG (trafficking from ER to golgi regulator); PARTICIPATES IN thyroid cancer pathway; INTERACTS WITH (+)-schisandrin B; 2,6-dinitrotoluene; 4-amino-2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC103690095; LOC360709; protein TFG-like; Trk-fused; Trk-fused gene; TRK-fused gene protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 57,354,607 - 57,381,071 (+) NCBI GRCr8 mRatBN7.2 11 43,885,542 - 43,911,976 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 43,885,661 - 43,911,976 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 52,668,579 - 52,694,926 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 45,330,191 - 45,356,541 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 44,454,301 - 44,480,654 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 46,180,189 - 46,206,723 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 46,179,940 - 46,206,721 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 50,047,639 - 50,059,704 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 44,826,798 - 44,853,093 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 44,884,386 - 44,910,680 (+) NCBI Celera 11 43,657,971 - 43,684,267 (+) NCBI Celera Cytogenetic Map 11 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tfg Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of TFG mRNA] CTD PMID:31150632 Tfg Rat 1,2-dimethylhydrazine multiple interactions ISO Tfg (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TFG mRNA CTD PMID:22206623 Tfg Rat 1,2-dimethylhydrazine decreases expression ISO Tfg (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of TFG mRNA CTD PMID:22206623 Tfg Rat 17beta-estradiol increases expression ISO Tfg (Mus musculus) 6480464 Estradiol results in increased expression of TFG mRNA CTD PMID:39298647 Tfg Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO TFG (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Tfg Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tfg (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TFG mRNA CTD PMID:21570461 Tfg Rat 2,4,6-tribromophenol decreases expression ISO TFG (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Tfg Rat 2,6-dimethoxyphenol multiple interactions ISO TFG (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 more ... CTD PMID:38598786 Tfg Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of TFG mRNA CTD PMID:21346803 Tfg Rat 4,4'-sulfonyldiphenol increases expression ISO Tfg (Mus musculus) 6480464 bisphenol S results in increased expression of TFG mRNA CTD PMID:39298647 Tfg Rat 4,4'-sulfonyldiphenol multiple interactions ISO TFG (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of TFG gene CTD PMID:31601247 Tfg Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of TFG mRNA CTD PMID:21346803 Tfg Rat acetylsalicylic acid increases expression ISO TFG (Homo sapiens) 6480464 Aspirin results in increased expression of TFG mRNA CTD PMID:15928584 Tfg Rat amiodarone increases expression ISO TFG (Homo sapiens) 6480464 Amiodarone results in increased expression of TFG mRNA CTD PMID:19774075 Tfg Rat aristolochic acid A decreases expression ISO TFG (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of TFG mRNA CTD PMID:33212167 Tfg Rat Aroclor 1254 decreases expression ISO Tfg (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of TFG mRNA CTD PMID:23650126 Tfg Rat arsenite(3-) affects expression ISO TFG (Homo sapiens) 6480464 arsenite affects the expression of TFG mRNA CTD PMID:22959463 Tfg Rat benzo[a]pyrene diol epoxide I decreases expression ISO TFG (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Tfg Rat beta-lapachone increases expression ISO TFG (Homo sapiens) 6480464 beta-lapachone results in increased expression of TFG mRNA CTD PMID:38218311 Tfg Rat bis(2-ethylhexyl) phthalate multiple interactions ISO TFG (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in decreased methylation of TFG promoter CTD PMID:33872906 Tfg Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of TFG mRNA CTD PMID:25181051 Tfg Rat bisphenol A increases expression ISO TFG (Homo sapiens) 6480464 bisphenol A results in increased expression of TFG protein CTD PMID:37567409 Tfg Rat bisphenol A decreases expression ISO TFG (Homo sapiens) 6480464 bisphenol A results in decreased expression of TFG protein CTD PMID:31675489 Tfg Rat bisphenol A decreases expression ISO Tfg (Mus musculus) 6480464 bisphenol A results in decreased expression of TFG mRNA CTD PMID:33221593 Tfg Rat bisphenol AF increases expression ISO TFG (Homo sapiens) 6480464 bisphenol AF results in increased expression of TFG protein CTD PMID:34186270 Tfg Rat Bisphenol B increases expression ISO TFG (Homo sapiens) 6480464 bisphenol B results in increased expression of TFG protein CTD PMID:34186270 Tfg Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of TFG mRNA CTD PMID:24136188 Tfg Rat caffeine decreases phosphorylation ISO TFG (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of TFG protein CTD PMID:35688186 Tfg Rat carbon nanotube increases expression ISO Tfg (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Tfg Rat cobalt dichloride increases expression ISO TFG (Homo sapiens) 6480464 cobaltous chloride results in increased expression of TFG mRNA CTD PMID:19320972 Tfg Rat cyclosporin A increases expression ISO TFG (Homo sapiens) 6480464 Cyclosporine results in increased expression of TFG mRNA CTD PMID:20106945 and PMID:25562108 Tfg Rat decabromodiphenyl ether increases expression ISO TFG (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of TFG protein CTD PMID:31675489 Tfg Rat Dibutyl phosphate affects expression ISO TFG (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of TFG mRNA CTD PMID:37042841 Tfg Rat dicrotophos increases expression ISO TFG (Homo sapiens) 6480464 dicrotophos results in increased expression of TFG mRNA CTD PMID:28302478 Tfg Rat enzyme inhibitor multiple interactions ISO TFG (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of TFG protein CTD PMID:23301498 Tfg Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of TFG mRNA CTD PMID:24136188 Tfg Rat folic acid multiple interactions ISO Tfg (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TFG mRNA CTD PMID:22206623 Tfg Rat FR900359 affects phosphorylation ISO TFG (Homo sapiens) 6480464 FR900359 affects the phosphorylation of TFG protein CTD PMID:37730182 Tfg Rat fulvestrant multiple interactions ISO TFG (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of TFG gene CTD PMID:31601247 Tfg Rat furfural multiple interactions ISO TFG (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of TFG protein and [Sodium Chloride co-treated with Furaldehyde] results in increased expression of TFG protein CTD PMID:38598786 Tfg Rat ivermectin decreases expression ISO TFG (Homo sapiens) 6480464 Ivermectin results in decreased expression of TFG protein CTD PMID:32959892 Tfg Rat mono(2-ethylhexyl) phthalate decreases expression ISO TFG (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of TFG mRNA CTD PMID:38685446 Tfg Rat mono(2-ethylhexyl) phthalate multiple interactions ISO TFG (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in decreased methylation of TFG promoter CTD PMID:33872906 Tfg Rat N-methyl-4-phenylpyridinium increases expression ISO Tfg (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of TFG protein CTD PMID:26558463 Tfg Rat nitrates multiple interactions ISO Tfg (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of TFG mRNA CTD PMID:35964746 Tfg Rat paracetamol decreases expression ISO TFG (Homo sapiens) 6480464 Acetaminophen results in decreased expression of TFG mRNA CTD PMID:21420995 Tfg Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of TFG mRNA CTD PMID:33387578 Tfg Rat paracetamol affects expression ISO Tfg (Mus musculus) 6480464 Acetaminophen affects the expression of TFG mRNA CTD PMID:17562736 Tfg Rat propiconazole increases expression ISO Tfg (Mus musculus) 6480464 propiconazole results in increased expression of TFG mRNA CTD PMID:21278054 Tfg Rat SB 431542 multiple interactions ISO TFG (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of TFG protein CTD PMID:37664457 Tfg Rat silicon dioxide decreases methylation ISO TFG (Homo sapiens) 6480464 Silicon Dioxide results in decreased methylation of TFG promoter CTD PMID:34973136 Tfg Rat sodium arsenite affects methylation ISO TFG (Homo sapiens) 6480464 sodium arsenite affects the methylation of TFG gene CTD PMID:28589171 Tfg Rat sodium arsenite increases expression ISO TFG (Homo sapiens) 6480464 sodium arsenite results in increased expression of TFG mRNA CTD PMID:38568856 Tfg Rat sodium arsenite increases expression ISO Tfg (Mus musculus) 6480464 sodium arsenite results in increased expression of TFG protein CTD PMID:29044176 Tfg Rat sodium chloride multiple interactions ISO TFG (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of TFG protein more ... CTD PMID:38598786 Tfg Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of TFG mRNA] CTD PMID:31150632 Tfg Rat tetrachloromethane increases expression ISO Tfg (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of TFG mRNA CTD PMID:31919559 Tfg Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of TFG mRNA CTD PMID:31150632 Tfg Rat thiram increases expression ISO TFG (Homo sapiens) 6480464 Thiram results in increased expression of TFG mRNA CTD PMID:38568856 Tfg Rat titanium dioxide increases methylation ISO Tfg (Mus musculus) 6480464 titanium dioxide results in increased methylation of TFG gene CTD PMID:35295148 Tfg Rat titanium dioxide decreases methylation ISO Tfg (Mus musculus) 6480464 titanium dioxide results in decreased methylation of TFG promoter CTD PMID:35295148 Tfg Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of TFG gene CTD PMID:27618143 Tfg Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of TFG mRNA CTD PMID:24136188 Tfg Rat trovafloxacin multiple interactions ISO Tfg (Mus musculus) 6480464 [trovafloxacin co-treated with lipopolysaccharide and E coli O55-B5] results in decreased expression of TFG mRNA CTD PMID:18930950 Tfg Rat valproic acid decreases methylation ISO TFG (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of TFG gene CTD PMID:29154799 Tfg Rat valproic acid affects expression ISO Tfg (Mus musculus) 6480464 Valproic Acid affects the expression of TFG mRNA CTD PMID:17292431 Tfg Rat valproic acid affects expression ISO TFG (Homo sapiens) 6480464 Valproic Acid affects the expression of TFG mRNA CTD PMID:25979313 Tfg Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of TFG mRNA CTD PMID:23034163
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (ISO) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) acetylsalicylic acid (ISO) amiodarone (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsenite(3-) (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) buspirone (EXP) caffeine (ISO) carbon nanotube (ISO) cobalt dichloride (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) enzyme inhibitor (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) furfural (ISO) ivermectin (ISO) mono(2-ethylhexyl) phthalate (ISO) N-methyl-4-phenylpyridinium (ISO) nitrates (ISO) paracetamol (EXP,ISO) propiconazole (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium chloride (ISO) tetrachloromethane (EXP,ISO) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) trovafloxacin (EXP,ISO) valproic acid (ISO) vinclozolin (EXP)
Tfg Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 57,354,607 - 57,381,071 (+) NCBI GRCr8 mRatBN7.2 11 43,885,542 - 43,911,976 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 43,885,661 - 43,911,976 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 52,668,579 - 52,694,926 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 45,330,191 - 45,356,541 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 44,454,301 - 44,480,654 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 46,180,189 - 46,206,723 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 46,179,940 - 46,206,721 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 50,047,639 - 50,059,704 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 44,826,798 - 44,853,093 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 44,884,386 - 44,910,680 (+) NCBI Celera 11 43,657,971 - 43,684,267 (+) NCBI Celera Cytogenetic Map 11 q12 NCBI
TFG Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 100,709,290 - 100,748,967 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 100,709,295 - 100,748,964 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 100,428,134 - 100,467,811 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 101,910,850 - 101,950,501 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 101,910,849 - 101,950,500 NCBI Celera 3 98,819,764 - 98,859,409 (+) NCBI Celera Cytogenetic Map 3 q12.2 NCBI HuRef 3 97,796,042 - 97,835,650 (+) NCBI HuRef CHM1_1 3 100,391,200 - 100,430,852 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 103,415,045 - 103,454,716 (+) NCBI T2T-CHM13v2.0
Tfg Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 56,510,692 - 56,541,801 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 56,510,695 - 56,537,813 (-) Ensembl GRCm39 Ensembl GRCm38 16 56,690,329 - 56,717,467 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 56,690,332 - 56,717,450 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 56,690,445 - 56,717,467 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 56,615,283 - 56,642,305 (-) NCBI MGSCv36 mm8 Celera 16 57,022,069 - 57,049,091 (-) NCBI Celera Cytogenetic Map 16 C1.1 NCBI cM Map 16 34.22 NCBI
Tfg Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955427 2,332,039 - 2,362,050 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955427 2,328,676 - 2,362,050 (+) NCBI ChiLan1.0 ChiLan1.0
TFG Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 98,645,102 - 98,689,238 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 98,649,884 - 98,694,020 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 97,801,918 - 97,841,646 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 104,482,338 - 104,521,919 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 104,482,388 - 104,521,919 (+) Ensembl panpan1.1 panPan2
TFG Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 33 7,240,912 - 7,265,526 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 33 7,236,613 - 7,265,309 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 33 7,393,273 - 7,422,811 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 33 7,376,622 - 7,406,194 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 33 7,376,504 - 7,405,977 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 33 7,264,310 - 7,293,448 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 33 7,310,882 - 7,340,324 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 33 7,642,320 - 7,671,902 (+) NCBI UU_Cfam_GSD_1.0
Tfg Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 149,621,052 - 149,657,176 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936630 2,515,822 - 2,555,299 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936630 2,518,944 - 2,555,054 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TFG Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 158,288,579 - 158,326,885 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 158,291,090 - 158,326,902 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 167,905,209 - 168,041,355 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TFG Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 80,144,976 - 80,189,139 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 80,146,721 - 80,189,248 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 86,377,515 - 86,416,821 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tfg
.
1300147 Bp187 Blood pressure QTL 187 3.67 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 11 1 69446234 Rat 724554 Iddm17 Insulin dependent diabetes mellitus QTL 17 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 18976208 86241447 Rat 70180 BpQTLcluster10 Blood pressure QTL cluster 10 3.19 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 11 34918041 79918041 Rat 8694376 Bw156 Body weight QTL 156 2.25 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 10755497 Bp388 Blood pressure QTL 388 2.76 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 11 19456205 76331918 Rat 724517 Uae18 Urinary albumin excretion QTL 18 3.7 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 16472047 44285911 Rat 10058952 Gmadr6 Adrenal mass QTL 6 2.29 0.0072 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 11 22959403 67959403 Rat 1300130 Rf20 Renal function QTL 20 4.44 kidney glomerulus integrity trait (VT:0010546) kidney glomerulus diameter (CMO:0001166) 11 29528418 60324829 Rat 1558659 Tescar1 Testicular tumor resistance QTL 1 3.9 testis integrity trait (VT:0010572) percentage of study population developing testis tumors during a period of time (CMO:0001261) 11 1041931 66113562 Rat 2298551 Neuinf10 Neuroinflammation QTL 10 3.7 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 11 31239134 78851519 Rat 1300135 Rf19 Renal function QTL 19 3.38 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 11 40946188 82566702 Rat 724563 Uae10 Urinary albumin excretion QTL 10 6 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 11 27672410 82846715 Rat 9589032 Epfw10 Epididymal fat weight QTL 10 9.29 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 11 23280456 68280456 Rat 9590313 Scort20 Serum corticosterone level QTL 20 6.51 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 11 23280456 68280456 Rat 8694424 Bw162 Body weight QTL 162 3.8 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 1300110 Stl7 Serum triglyceride level QTL 7 4.64 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 11 29528418 82566702 Rat 1641927 Alcrsp10 Alcohol response QTL 10 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 11 8436674 53436674 Rat
AA926352
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 43,911,770 - 43,911,873 (+) MAPPER mRatBN7.2 Rnor_6.0 11 46,206,518 - 46,206,620 NCBI Rnor6.0 Rnor_5.0 11 49,392,219 - 49,392,321 UniSTS Rnor5.0 RGSC_v3.4 11 44,852,888 - 44,852,990 UniSTS RGSC3.4 Celera 11 43,684,062 - 43,684,164 UniSTS RH 3.4 Map 11 326.1 UniSTS Cytogenetic Map 11 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000048417 ⟹ ENSRNOP00000042252
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 43,885,731 - 43,911,976 (+) Ensembl Rnor_6.0 Ensembl 11 46,184,871 - 46,206,721 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000081169
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 11 46,864,924 - 46,878,177 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000088152 ⟹ ENSRNOP00000075029
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 43,885,661 - 43,911,926 (+) Ensembl Rnor_6.0 Ensembl 11 46,179,940 - 46,206,478 (+) Ensembl
RefSeq Acc Id:
NM_001012144 ⟹ NP_001012144
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 57,354,776 - 57,381,071 (+) NCBI mRatBN7.2 11 43,885,675 - 43,911,976 (+) NCBI Rnor_6.0 11 46,180,247 - 46,206,723 (+) NCBI Rnor_5.0 11 50,047,639 - 50,059,704 (+) NCBI RGSC_v3.4 11 44,826,798 - 44,853,093 (+) RGD Celera 11 43,657,971 - 43,684,267 (+) RGD
Sequence:
CGCCCCTGCGCTTCCCACCTGCCACGTACGGGACCGCGGCTCTTGCTAGGCTCGTTGGGTGTGTGCGATTGGCCAGGTCCGCGCAGCCTGCAGCTCGGCGACGATCGGCGGAGGGCGGCCGGGTGGAC
hide sequence
RefSeq Acc Id:
XM_006248236 ⟹ XP_006248298
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 57,354,607 - 57,381,071 (+) NCBI mRatBN7.2 11 43,885,545 - 43,911,976 (+) NCBI Rnor_6.0 11 46,180,189 - 46,206,280 (+) NCBI
Sequence:
CTGGTTGGCCTGTCCGTCTTGAGGCGGGGCGCCAGGGCAGTTTTTTTTTCTTTGCTCCCGCCCC
hide sequence
RefSeq Acc Id:
XM_006248237 ⟹ XP_006248299
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 57,354,623 - 57,381,071 (+) NCBI mRatBN7.2 11 43,885,545 - 43,911,662 (+) NCBI Rnor_6.0 11 46,180,189 - 46,206,723 (+) NCBI
Sequence:
CTGGTTGGCCTGTCCGTCTTGAGGCGGGGCGCCAGGGCAGTTTTTTTTTCTTTGCTCCCGCCCC
hide sequence
RefSeq Acc Id:
XM_017598026 ⟹ XP_017453515
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 57,354,711 - 57,380,285 (+) NCBI mRatBN7.2 11 43,885,545 - 43,911,976 (+) NCBI Rnor_6.0 11 46,180,189 - 46,206,723 (+) NCBI
Sequence:
CTGGTTGGCCTGTCCGTCTTGAGGCGGGGCGCCAGGGCAGTTTTTTTTTCTTTGCTCCCGCCCC
hide sequence
RefSeq Acc Id:
XM_039088478 ⟹ XP_038944406
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 57,354,767 - 57,381,071 (+) NCBI mRatBN7.2 11 43,885,545 - 43,911,662 (+) NCBI
RefSeq Acc Id:
XM_039088479 ⟹ XP_038944407
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 57,354,711 - 57,380,285 (+) NCBI mRatBN7.2 11 43,885,542 - 43,911,976 (+) NCBI
RefSeq Acc Id:
XM_039088480 ⟹ XP_038944408
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 57,354,711 - 57,380,285 (+) NCBI mRatBN7.2 11 43,885,542 - 43,911,976 (+) NCBI
RefSeq Acc Id:
XM_063270637 ⟹ XP_063126707
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 57,354,775 - 57,381,071 (+) NCBI
RefSeq Acc Id:
XR_010055962
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 57,354,704 - 57,380,285 (+) NCBI
RefSeq Acc Id:
NP_001012144 ⟸ NM_001012144
- UniProtKB:
Q6AYR1 (UniProtKB/TrEMBL), A6IQP2 (UniProtKB/TrEMBL)
- Sequence:
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGE
hide sequence
RefSeq Acc Id:
XP_006248298 ⟸ XM_006248236
- Peptide Label:
isoform X2
- Sequence:
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGD
hide sequence
RefSeq Acc Id:
XP_006248299 ⟸ XM_006248237
- Peptide Label:
isoform X3
- UniProtKB:
A6IQP2 (UniProtKB/TrEMBL)
- Sequence:
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGE
hide sequence
RefSeq Acc Id:
XP_017453515 ⟸ XM_017598026
- Peptide Label:
isoform X4
- UniProtKB:
Q4R1A4 (UniProtKB/TrEMBL), A0A0G2K9K4 (UniProtKB/TrEMBL)
- Sequence:
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGE
hide sequence
Ensembl Acc Id:
ENSRNOP00000042252 ⟸ ENSRNOT00000048417
Ensembl Acc Id:
ENSRNOP00000075029 ⟸ ENSRNOT00000088152
RefSeq Acc Id:
XP_038944407 ⟸ XM_039088479
- Peptide Label:
isoform X5
- UniProtKB:
A0A0G2K9K4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038944408 ⟸ XM_039088480
- Peptide Label:
isoform X6
- UniProtKB:
A0A0G2K9K4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038944406 ⟸ XM_039088478
- Peptide Label:
isoform X1
- UniProtKB:
Q6AYR1 (UniProtKB/TrEMBL), A6IQP2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063126707 ⟸ XM_063270637
- Peptide Label:
isoform X3
- UniProtKB:
A6IQP2 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Tfg
trafficking from ER to golgi regulator
LOC103690095
protein TFG-like
Data merged from RGD:9131838
737654 PROVISIONAL
2019-08-05
Tfg
trafficking from ER to golgi regulator
Tfg
Trk-fused gene
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2014-08-25
LOC103690095
protein TFG-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-12-06
Tfg
Trk-fused gene
Tfg_predicted
Trk-fused gene (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Tfg_predicted
Trk-fused gene (predicted)
Symbol and Name status set to approved
70820 APPROVED
