Advanced Search (OLGA)

Gene: Aga (aspartylglucosaminidase) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Aga

Name:

aspartylglucosaminidase

RGD ID:

1309646

Description:

Enables N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity and identical protein binding activity. Predicted to be involved in protein deglycosylation. Predicted to be located in endoplasmic reticulum and extracellular space. Predicted to be active in lysosome. Human ortholog(s) of this gene implicated in aspartylglucosaminuria and lysosomal storage disease. Orthologous to human AGA (aspartylglucosaminidase); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

glycosylasparaginase; LOC290923; MGC112709; n(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	AGA (aspartylglucosaminidase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Aga (aspartylglucosaminidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Aga (aspartylglucosaminidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	AGA (aspartylglucosaminidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	AGA (aspartylglucosaminidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Aga (aspartylglucosaminidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	AGA (aspartylglucosaminidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	AGA (aspartylglucosaminidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Aga (aspartylglucosaminidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	AGA (aspartylglucosaminidase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Aga (aspartylglucosaminidase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	aga (aspartylglucosaminidase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG10474	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG1827	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG4372	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	R04B3.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	aga	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	45,191,215 - 45,249,537 (-)	NCBI		GRCr8
mRatBN7.2	16	38,504,661 - 38,516,607 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	38,504,663 - 38,516,606 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	43,852,185 - 43,864,091 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	47,212,763 - 47,224,669 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	42,568,414 - 42,580,309 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	41,222,225 - 41,234,169 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	41,222,238 - 41,234,095 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	40,992,072 - 41,004,008 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	41,383,536 - 41,395,394 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	41,383,601 - 41,395,548 (-)	NCBI
Celera	16	36,605,222 - 36,617,080 (-)	NCBI		Celera
Cytogenetic Map	16	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aga	Rat	lysosomal storage disease	susceptibility	ISO	AGA (Homo sapiens)	1598773		RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aga	Rat	aspartylglucosaminuria		ISO	AGA (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:10399108 more ...
Aga	Rat	autistic disorder		ISO	AGA (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autism	ClinVar	PMID:10571008 more ...
Aga	Rat	genetic disease		ISO	AGA (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:11309371 more ...
Aga	Rat	intellectual disability		ISO	AGA (Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar	PMID:11309371 more ...
Aga	Rat	Neurodevelopmental Disorders		ISO	AGA (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:11309371 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aga	Rat	aspartylglucosaminuria		ISO	AGA (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aga	Rat	aspartylglucosaminuria		ISS	Aga (Mus musculus)	13592920	OMIM:208400	MouseDO

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aga	Rat	aspartylglucosaminuria		ISO	AGA (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aga	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of AGA mRNA]	CTD	PMID:31150632
Aga	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Aga (Mus musculus)	6480464	[TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression of AGA mRNA	CTD	PMID:25975270
Aga	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of AGA mRNA	CTD	PMID:34747641
Aga	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of AGA mRNA	CTD	PMID:21346803
Aga	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	AGA (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of AGA mRNA	CTD	PMID:28628672
Aga	Rat	4,4'-sulfonyldiphenol	multiple interactions	ISO	AGA (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of AGA mRNA	CTD	PMID:28628672
Aga	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of AGA mRNA	CTD	PMID:28959563
Aga	Rat	Aroclor 1254	decreases expression	ISO	Aga (Mus musculus)	6480464	Chlorodiphenyl (54% Chlorine) results in decreased expression of AGA mRNA	CTD	PMID:23650126
Aga	Rat	arsane	multiple interactions	ISO	AGA (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AGA mRNA more ...	CTD	PMID:32525701 and PMID:39836092
Aga	Rat	arsenic atom	multiple interactions	ISO	AGA (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AGA mRNA more ...	CTD	PMID:32525701 and PMID:39836092
Aga	Rat	benzo[a]pyrene	increases expression	ISO	Aga (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of AGA mRNA	CTD	PMID:21715664
Aga	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Aga (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of AGA mRNA	CTD	PMID:33754040
Aga	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of AGA mRNA	CTD	PMID:25181051 more ...
Aga	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of AGA mRNA	CTD	PMID:34947998
Aga	Rat	bisphenol AF	increases expression	ISO	AGA (Homo sapiens)	6480464	bisphenol AF results in increased expression of AGA protein	CTD	PMID:34186270
Aga	Rat	cadmium dichloride	decreases expression	ISO	AGA (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of AGA mRNA	CTD	PMID:38568856
Aga	Rat	capsaicin	decreases expression	EXP		6480464	Capsaicin results in decreased expression of AGA mRNA	CTD	PMID:16278290
Aga	Rat	carbamazepine	affects expression	ISO	AGA (Homo sapiens)	6480464	Carbamazepine affects the expression of AGA mRNA	CTD	PMID:25979313
Aga	Rat	cobalt dichloride	decreases expression	ISO	AGA (Homo sapiens)	6480464	cobaltous chloride results in decreased expression of AGA mRNA	CTD	PMID:19376846
Aga	Rat	copper atom	multiple interactions	ISO	AGA (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in increased expression of AGA mRNA	CTD	PMID:20971185
Aga	Rat	copper(0)	multiple interactions	ISO	AGA (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in increased expression of AGA mRNA	CTD	PMID:20971185
Aga	Rat	cyclosporin A	increases expression	ISO	AGA (Homo sapiens)	6480464	Cyclosporine results in increased expression of AGA mRNA	CTD	PMID:20106945 and PMID:21632981
Aga	Rat	dexamethasone	multiple interactions	ISO	AGA (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of AGA mRNA	CTD	PMID:28628672
Aga	Rat	dibutyl phthalate	decreases expression	ISO	Aga (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of AGA mRNA	CTD	PMID:17361019 and PMID:21266533
Aga	Rat	dicrotophos	decreases expression	ISO	AGA (Homo sapiens)	6480464	dicrotophos results in decreased expression of AGA mRNA	CTD	PMID:28302478
Aga	Rat	disodium selenite	increases expression	ISO	AGA (Homo sapiens)	6480464	Sodium Selenite results in increased expression of AGA mRNA	CTD	PMID:18175754
Aga	Rat	fonofos	decreases methylation	ISO	AGA (Homo sapiens)	6480464	Fonofos results in decreased methylation of AGA promoter	CTD	PMID:22847954
Aga	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of AGA mRNA	CTD	PMID:22061828
Aga	Rat	indometacin	multiple interactions	ISO	AGA (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of AGA mRNA	CTD	PMID:28628672
Aga	Rat	isotretinoin	decreases expression	ISO	AGA (Homo sapiens)	6480464	Isotretinoin results in decreased expression of AGA mRNA	CTD	PMID:20436886
Aga	Rat	manganese atom	multiple interactions	ISO	AGA (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AGA mRNA	CTD	PMID:39836092
Aga	Rat	manganese(0)	multiple interactions	ISO	AGA (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AGA mRNA	CTD	PMID:39836092
Aga	Rat	manganese(II) chloride	multiple interactions	ISO	AGA (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AGA mRNA	CTD	PMID:39836092
Aga	Rat	methylmercury chloride	decreases expression	ISO	AGA (Homo sapiens)	6480464	methylmercuric chloride results in decreased expression of AGA mRNA	CTD	PMID:28001369
Aga	Rat	mono(2-ethylhexyl) phthalate	decreases expression	ISO	AGA (Homo sapiens)	6480464	mono-(2-ethylhexyl)phthalate results in decreased expression of AGA mRNA	CTD	PMID:38685446
Aga	Rat	p-toluidine	increases expression	EXP		6480464	4-toluidine results in increased expression of AGA mRNA	CTD	PMID:27638505
Aga	Rat	paracetamol	affects expression	ISO	Aga (Mus musculus)	6480464	Acetaminophen affects the expression of AGA mRNA	CTD	PMID:17562736
Aga	Rat	paracetamol	decreases expression	ISO	AGA (Homo sapiens)	6480464	Acetaminophen results in decreased expression of AGA mRNA	CTD	PMID:27761495
Aga	Rat	paraquat	decreases expression	EXP		6480464	Paraquat results in decreased expression of AGA mRNA	CTD	PMID:32680482
Aga	Rat	parathion	decreases methylation	ISO	AGA (Homo sapiens)	6480464	Parathion results in decreased methylation of AGA promoter	CTD	PMID:22847954
Aga	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Aga (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of AGA mRNA	CTD	PMID:36331819
Aga	Rat	phenobarbital	affects expression	ISO	AGA (Homo sapiens)	6480464	Phenobarbital affects the expression of AGA mRNA	CTD	PMID:19159669
Aga	Rat	quinolin-8-ol	decreases expression	ISO	AGA (Homo sapiens)	6480464	Oxyquinoline results in decreased expression of AGA mRNA	CTD	PMID:21632981
Aga	Rat	rotenone	increases expression	EXP		6480464	Rotenone results in increased expression of AGA protein	CTD	PMID:35544339
Aga	Rat	sodium arsenate	multiple interactions	ISO	AGA (Homo sapiens)	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of AGA mRNA	CTD	PMID:32525701
Aga	Rat	sodium arsenite	affects methylation	ISO	AGA (Homo sapiens)	6480464	sodium arsenite affects the methylation of AGA gene	CTD	PMID:28589171
Aga	Rat	sodium arsenite	multiple interactions	ISO	AGA (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AGA mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of AGA mRNA	CTD	PMID:39836092
Aga	Rat	sunitinib	decreases expression	ISO	AGA (Homo sapiens)	6480464	Sunitinib results in decreased expression of AGA mRNA	CTD	PMID:31533062
Aga	Rat	terbufos	decreases methylation	ISO	AGA (Homo sapiens)	6480464	terbufos results in decreased methylation of AGA promoter	CTD	PMID:22847954
Aga	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of AGA mRNA	CTD	PMID:31150632
Aga	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of AGA mRNA]	CTD	PMID:31150632
Aga	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of AGA mRNA	CTD	PMID:34492290
Aga	Rat	tolcapone	decreases expression	EXP		6480464	tolcapone results in decreased expression of AGA mRNA	CTD	PMID:24136188
Aga	Rat	tunicamycin	increases expression	ISO	AGA (Homo sapiens)	6480464	Tunicamycin results in increased expression of AGA mRNA	CTD	PMID:29453283
Aga	Rat	valproic acid	affects expression	ISO	AGA (Homo sapiens)	6480464	Valproic Acid affects the expression of AGA mRNA	CTD	PMID:25979313
Aga	Rat	valproic acid	increases expression	ISO	AGA (Homo sapiens)	6480464	Valproic Acid results in increased expression of AGA mRNA	CTD	PMID:23179753 more ...
Aga	Rat	vorinostat	increases expression	ISO	AGA (Homo sapiens)	6480464	vorinostat results in increased expression of AGA mRNA	CTD	PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aga	Rat	biological_process		ND		1598407	12/2006: no relevant rat data	RGD
Aga	Rat	protein deglycosylation	involved_in	ISO	AGA (Homo sapiens)	1624291	PMID:1281977 and PMID:1904874	RGD	PMID:1281977 and PMID:1904874
Aga	Rat	proteolysis	involved_in	IEA	UniProtKB-KW:KW-0645	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aga	Rat	cytoplasm	is_active_in	IBA	MGI:104873 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Aga	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB:P20933 and ensembl:ENSP00000264595	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aga	Rat	endoplasmic reticulum	located_in	ISO	AGA (Homo sapiens)	1624291	PMID:8776587	RGD	PMID:8776587
Aga	Rat	extracellular space	located_in	IEA	UniProtKB:P20933 and ensembl:ENSP00000264595	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aga	Rat	extracellular space	located_in	ISO	AGA (Homo sapiens)	1624291	PMID:25645918	RGD	PMID:25645918
Aga	Rat	lysosome	located_in	IEA	UniProtKB:P20933 and ensembl:ENSP00000264595	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aga	Rat	lysosome	located_in	IEA	UniProtKB-KW:KW-0458	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Aga	Rat	lysosome	located_in	IEA	UniProtKB-SubCell:SL-0158	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Aga	Rat	lysosome	located_in	ISO	Aga (Mus musculus)	1624291	PMID:29514215	RGD	PMID:29514215
Aga	Rat	lysosome	is_active_in	IBA	MGI:104873 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Aga	Rat	lysosome	located_in	ISO	AGA (Homo sapiens)	1624291	PMID:8776587	RGD	PMID:8776587
Aga	Rat	lysosome	located_in	IEA	UniProtKB:Q64191 and ensembl:ENSMUSP00000033920	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aga	Rat	hydrolase activity	enables	IEA	InterPro:IPR000246	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Aga	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Aga	Rat	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides	enables	IEA	ARBA:ARBA00026848	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Aga	Rat	identical protein binding		IDA		1598775		RGD
Aga	Rat	N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity		IDA		1598775		RGD
Aga	Rat	N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity	enables	IEA	EC:3.5.1.26	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Aga	Rat	N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity	enables	IEA	RHEA:11544	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Aga	Rat	N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity	enables	ISO	Aga (Mus musculus)	1624291	PMID:8586423	RGD	PMID:8586423
Aga	Rat	N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity	enables	IBA	MGI:104873 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Aga	Rat	N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity	enables	ISO	AGA (Homo sapiens)	1624291	PMID:1281977 and PMID:1904874	RGD	PMID:1281977 and PMID:1904874
Aga	Rat	N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity	enables	IEA	UniProtKB:P20933 and ensembl:ENSP00000264595	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aga	Rat	N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity	enables	IEA	UniProtKB:Q64191 and ensembl:ENSMUSP00000033920	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aga	Rat	peptidase activity	enables	IEA	UniProtKB-KW:KW-0645	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Aga	Rat	protein binding	enables	ISO	AGA (Homo sapiens)	1624291	UniProtKB:O60333-2 more ...	RGD	PMID:32296183 and PMID:32814053

BioCyc Pathways

L-asparagine degradation III (mammalian)

#	Reference Title	Reference Citation
1.	Co-localization of hydrolytic enzymes with widely disparate pH optima: implications for the regulation of lysosomal pH.	Butor C, etal., J Cell Sci. 1995 Jun;108 ( Pt 6):2213-9.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Aspartylglucosaminuria: cDNA encoding human aspartylglucosaminidase and the missense mutation causing the disease.	Ikonen E, etal., EMBO J. 1991 Jan;10(1):51-8.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Comprehensive gene review and curation	RGD comprehensive gene curation
11.	Purification and characterization of rat liver glycosylasparaginase.	Tollersrud OK and Aronson NN Jr, Biochem J. 1989 May 15;260(1):101-8.

PMID:1281977	PMID:1554372	PMID:1904874	PMID:8586423	PMID:8776587	PMID:12477932	PMID:15489334	PMID:23376485	PMID:25645918	PMID:29514215

Aga
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	45,191,215 - 45,249,537 (-)	NCBI		GRCr8
mRatBN7.2	16	38,504,661 - 38,516,607 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	38,504,663 - 38,516,606 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	43,852,185 - 43,864,091 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	47,212,763 - 47,224,669 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	42,568,414 - 42,580,309 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	41,222,225 - 41,234,169 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	41,222,238 - 41,234,095 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	40,992,072 - 41,004,008 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	41,383,536 - 41,395,394 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	41,383,601 - 41,395,548 (-)	NCBI
Celera	16	36,605,222 - 36,617,080 (-)	NCBI		Celera
Cytogenetic Map	16	p11	NCBI

AGA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	177,430,774 - 177,442,437 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	177,430,774 - 177,442,437 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	178,351,928 - 178,363,591 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	178,588,918 - 178,600,585 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	178,727,072 - 178,738,740	NCBI
Celera	4	175,679,083 - 175,690,820 (-)	NCBI		Celera
Cytogenetic Map	4	q34.3	NCBI
HuRef	4	174,102,201 - 174,113,937 (-)	NCBI		HuRef
CHM1_1	4	178,328,375 - 178,340,109 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	180,769,443 - 180,781,108 (-)	NCBI		T2T-CHM13v2.0

Aga
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	53,964,718 - 53,976,457 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	53,964,762 - 53,976,456 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	53,511,683 - 53,523,422 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	53,511,727 - 53,523,421 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	54,597,080 - 54,608,776 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	55,010,424 - 55,022,120 (+)	NCBI		MGSCv36	mm8
Celera	8	56,224,973 - 56,236,712 (+)	NCBI		Celera
Cytogenetic Map	8	B1.3	NCBI
cM Map	8	29.13	NCBI

Aga
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	30,471,809 - 30,482,653 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955403	30,471,809 - 30,482,653 (+)	NCBI	ChiLan1.0	ChiLan1.0

AGA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	175,176,804 - 175,188,178 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	175,540,655 - 175,551,997 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	169,624,480 - 169,635,810 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	181,859,116 - 181,870,473 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	181,855,136 - 181,870,473 (-)	Ensembl	panpan1.1		panPan2

AGA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	16	52,314,860 - 52,324,879 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	16	52,314,535 - 52,324,894 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	16	47,809,385 - 47,818,758 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	16	54,618,058 - 54,629,014 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	16	54,618,088 - 54,629,029 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	16	52,515,396 - 52,524,764 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	16	53,109,738 - 53,120,301 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	16	53,347,863 - 53,357,457 (+)	NCBI		UU_Cfam_GSD_1.0

Aga
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404943	27,436,705 - 27,447,598 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936516	7,847,356 - 7,861,966 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936516	7,850,995 - 7,861,883 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

AGA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	39,701,310 - 39,713,496 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	39,702,900 - 39,714,566 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	45,613,331 - 45,623,930 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

AGA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	123,532,215 - 123,544,658 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	123,528,800 - 123,544,623 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	103,649,972 - 103,662,332 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Aga
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624769	8,549,598 - 8,560,856 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624769	8,549,545 - 8,560,423 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Aga
18 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	98
Count of miRNA genes:	85
Interacting mature miRNAs:	94
Transcripts:	ENSRNOT00000000120
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631561	Hcuc2	Hepatic copper content QTL 2	2.8		liver copper amount (VT:0003065)	liver total copper weight (CMO:0001507)	16	1	39533949	Rat
70215	Niddm29	Non-insulin dependent diabetes mellitus QTL 29	3.54		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	16	19004435	75226532	Rat
1578768	Stresp22	Stress response QTL 22	2.8		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	16	35288870	80288870	Rat
2302057	Pia29	Pristane induced arthritis QTL 29	3.6	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	16	21735975	66735975	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39533930	Rat
737819	Hcas4	Hepatocarcinoma susceptibility QTL 4	4.43		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	16	4227609	46975965	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	44977551	Rat
6903294	Stl30	Serum triglyceride level QTL 30	2.6	0.0013	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	16	25152793	70152793	Rat
2293690	Bss45	Bone structure and strength QTL 45	5.13	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	16	37752156	82752156	Rat
61338	Bp23	Blood pressure QTL 23	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4227609	49227609	Rat
61405	Niddm6	Non-insulin dependent diabetes mellitus QTL 6	3.66	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	16	4227609	48972724	Rat
2300163	Bmd64	Bone mineral density QTL 64	5.3	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	16	37752156	82752156	Rat
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	1	44588133	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	4227609	43025077	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4227609	60252231	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39533930	Rat
8694453	Bw172	Body weight QTL 172	8.33	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	16	24325513	69325513	Rat
1298529	Arunc1	Aerobic running capacity QTL 1	4		exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	31951520	60148445	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	832236	59492508	Rat
2306902	Bp339	Blood pressure QTL 339		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	3380150	43025077	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	832236	59492508	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	832236	59492508	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	832236	46053497	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	1	43534949	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	832236	59492508	Rat

RH134567

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	16	p11	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001031641	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006253111	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039094423	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039094424	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275263	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010058288	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC098718	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473995	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000120 ⟹ ENSRNOP00000000120

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	38,504,665 - 38,516,595 (-)	Ensembl
Rnor_6.0 Ensembl	16	41,222,238 - 41,234,095 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107358 ⟹ ENSRNOP00000093756

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	38,504,663 - 38,516,593 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116014 ⟹ ENSRNOP00000078440

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	38,504,663 - 38,516,606 (-)	Ensembl

RefSeq Acc Id:

NM_001031641 ⟹ NP_001026811

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	45,237,565 - 45,249,423 (-)	NCBI
mRatBN7.2	16	38,504,674 - 38,516,532 (-)	NCBI
Rnor_6.0	16	41,222,238 - 41,234,095 (-)	NCBI
Rnor_5.0	16	40,992,072 - 41,004,008 (-)	NCBI
RGSC_v3.4	16	41,383,536 - 41,395,394 (-)	RGD
Celera	16	36,605,222 - 36,617,080 (-)	RGD

Sequence:

show sequence

CTCTGCTATGGCGCGGAAGTGGAATCTCCCTTTTCTTCTCCTGCCGCTCGTTCTGGGTATACCCCTGGTGCGGGGCTCCAACCCTCTACCCCTGGTCGTCAACACTTGGCCTTTTAAGAATGCCACCG
AAGCAGCGTGGTGGACATTAGTGTCTGGAGGTTCTGCCCTGGATGCGGTGGAGAAGGGCTGTGCTATGTGTGAAAAGGAGCAATGTGGTGGTACTGTAGGCTTTGGAGGAAGTCCTGATGAAGTTGGG
GAAACCACCCTGGATGCCATGATCATGGATGGCACTGCTATGGATGTGGGAGCAGTGGGAGGCCTTAGAAGAATTAAAAATGCTATTGGAGTGGCTCGGAAAGTCTTGGAGCATACCACGCACACGCT
TTTAGTGGGGGACTCAGCCACCAAGTTTGCTGTAAGTATGGGGTTTACCAGTGAGGACTTATCTACCAATACCTCAAGAGCTCTTCATTCAGATTGGCTTTCTCGAAACTGCCAGCCAAATTATTGGA
GAAACGTTATACCAGATCCTTCAAAATACTGTGGACCCTACAAACCACCTGATTTCTTAGAGCAGAATAACCGTGCCCACAAAGAAGTGGATATCCACAGTCATGATACTATTGGCATGGTTGTAATC
CATAAGACGGGACATACTGCTGCTGGCACATCTACAAATGGTTTAAAATTCAAAATACCTGGTCGTGTAGGAGACTCACCAATCCCTGGAGCTGGAGCCTATGCTGATGACATGGCTGGAGCAGCTGC
GGCCACTGGAGATGGTGACACACTCCTGAGATTTCTGCCAAGCTACCAAGCTGTAGAATATATGAGAGGAGGAGATGATCCAGCCAGAGCTTGCCAAAAAGTGATTTCAAGAATTCAGAAATATTATC
CAAAATTCTTTGGAGCTGTTATATGTGCCAATGTGACAGGAAGTTATGGTGCTGCTTGCAACAGACTTCCAACATTTACTCAATTTAGTTTCATGGTTTATAACTCTCTACACAATCAGGCGATTGAA
GAAAAAGTAGACTGCATGTAATCTCTCTTGTCTGTCAACATATGTATTTAAAGAGGAAAGACGTGACGGCGGGAAGGTTGCTCACTGACATGGAGTGATCCTCAATTATTTCAAGTTCTTGTGTAAAT
TAAGTGCAAAAATAAATATGCTGTAGTGTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006253111 ⟹ XP_006253173

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	45,237,552 - 45,249,510 (-)	NCBI
mRatBN7.2	16	38,504,661 - 38,516,607 (-)	NCBI
Rnor_6.0	16	41,222,225 - 41,234,169 (-)	NCBI
Rnor_5.0	16	40,992,072 - 41,004,008 (-)	NCBI

Sequence:

show sequence

GGCCGAGACCTTTCTCGCGCTGGTCTGCTGGGTGCGCGGTCGGGCGGGACTTTTCTCACGCTGC
TCGGCGGGCTCTCTGCTATGGCGCGGAAGTGGAATCTCCCTTTTCTTCTCCTGCCGCTCGTTCTGGGTATACCCCTGGTGCGGGGCTCCAACCCTCTACCCCTGGTCGTCAACACTTGGCCTTTTAAG
AATGCCACCGAAGCAGTTTCAGTTATCTCTCTTAGAGGCGACATATTTGCCACACAGAGAAAAACAGTTACTGCGTGGTGGACATTAGTGTCTGGAGGTTCTGCCCTGGATGCGGTGGAGAAGGGCTG
TGCTATGTGTGAAAAGGAGCAATGTGGTGGTACTGTAGGCTTTGGAGGAAGTCCTGATGAAGTTGGGGAAACCACCCTGGATGCCATGATCATGGATGGCACTGCTATGGATGTGGGAGCAGTGGGAG
GCCTTAGAAGAATTAAAAATGCTATTGGAGTGGCTCGGAAAGTCTTGGAGCATACCACGCACACGCTTTTAGTGGGGGACTCAGCCACCAAGTTTGCTGTAAGTATGGGGTTTACCAGTGAGGACTTA
TCTACCAATACCTCAAGAGCTCTTCATTCAGATTGGCTTTCTCGAAACTGCCAGCCAAATTATTGGAGAAACGTTATACCAGATCCTTCAAAATACTGTGGACCCTACAAACCACCTGATTTCTTAGA
GCAGAATAACCGTGCCCACAAAGAAGTGGATATCCACAGTCATGATACTATTGGCATGGTTGTAATCCATAAGACGGGACATACTGCTGCTGGCACATCTACAAATGGTTTAAAATTCAAAATACCTG
GTCGTGTAGGAGACTCACCAATCCCTGGAGCTGGAGCCTATGCTGATGACATGGCTGGAGCAGCTGCGGCCACTGGAGATGGTGACACACTCCTGAGATTTCTGCCAAGCTACCAAGCTGTAGAATAT
ATGAGAGGAGGAGATGATCCAGCCAGAGCTTGCCAAAAAGTGATTTCAAGAATTCAGAAATATTATCCAAAATTCTTTGGAGCTGTTATATGTGCCAATGTGACAGGAAGTTATGGTGCTGCTTGCAA
CAGACTTCCAACATTTACTCAATTTAGTTTCATGGTTTATAACTCTCTACACAATCAGGCGATTGAAGAAAAAGTAGACTGCATGTAATCTCTCTTGTCTGTCAACATATGTATTTAAAGAGGAAAGA
CGTGACGGCGGGAAGGTTGCTCACTGACATGGAGTGATCCTCAATTATTTCAAGTTCTTGTGTAAATTAAGTGCAAAAATAAATATGCTGTAGTGTTGTTTCTGTATCTA

hide sequence

RefSeq Acc Id:

XM_039094423 ⟹ XP_038950351

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	45,237,552 - 45,249,429 (-)	NCBI
mRatBN7.2	16	38,504,661 - 38,516,579 (-)	NCBI

RefSeq Acc Id:

XM_039094424 ⟹ XP_038950352

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	45,237,552 - 45,249,418 (-)	NCBI
mRatBN7.2	16	38,504,661 - 38,516,535 (-)	NCBI

RefSeq Acc Id:

XM_063275263 ⟹ XP_063131333

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	45,220,858 - 45,249,537 (-)	NCBI

RefSeq Acc Id:

XR_010058288

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	45,191,215 - 45,249,537 (-)	NCBI


Protein RefSeqs	NP_001026811	(Get FASTA)	NCBI Sequence Viewer
	XP_006253173	(Get FASTA)	NCBI Sequence Viewer
	XP_038950351	(Get FASTA)	NCBI Sequence Viewer
	XP_038950352	(Get FASTA)	NCBI Sequence Viewer
	XP_063131333	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH98718	(Get FASTA)	NCBI Sequence Viewer
	EDL78937	(Get FASTA)	NCBI Sequence Viewer
	EDL78938	(Get FASTA)	NCBI Sequence Viewer
	EDL78939	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000000120
	ENSRNOP00000000120.3
	ENSRNOP00000078440
	ENSRNOP00000093756
GenBank Protein	P30919	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001026811 ⟸ NM_001031641
- Peptide Label:	precursor
- UniProtKB:	Q4G065 (UniProtKB/Swiss-Prot), P30919 (UniProtKB/Swiss-Prot), A6JPI4 (UniProtKB/TrEMBL), A0A8I5ZKU5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MARKWNLPFLLLPLVLGIPLVRGSNPLPLVVNTWPFKNATEAAWWTLVSGGSALDAVEKGCAMCEKEQCGGTVGFGGSPDEVGETTLDAMIMDGTAMDVGAVGGLRRIKNAIGVARKVLEHTTHTLLV GDSATKFAVSMGFTSEDLSTNTSRALHSDWLSRNCQPNYWRNVIPDPSKYCGPYKPPDFLEQNNRAHKEVDIHSHDTIGMVVIHKTGHTAAGTSTNGLKFKIPGRVGDSPIPGAGAYADDMAGAAAAT GDGDTLLRFLPSYQAVEYMRGGDDPARACQKVISRIQKYYPKFFGAVICANVTGSYGAACNRLPTFTQFSFMVYNSLHNQAIEEKVDCM hide sequence

RefSeq Acc Id:	XP_006253173 ⟸ XM_006253111
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6AL08 (UniProtKB/TrEMBL), A0A8I5ZKU5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MARKWNLPFLLLPLVLGIPLVRGSNPLPLVVNTWPFKNATEAVSVISLRGDIFATQRKTVTAWWTLVSGGSALDAVEKGCAMCEKEQCGGTVGFGGSPDEVGETTLDAMIMDGTAMDVGAVGGLRRIK NAIGVARKVLEHTTHTLLVGDSATKFAVSMGFTSEDLSTNTSRALHSDWLSRNCQPNYWRNVIPDPSKYCGPYKPPDFLEQNNRAHKEVDIHSHDTIGMVVIHKTGHTAAGTSTNGLKFKIPGRVGDS PIPGAGAYADDMAGAAAATGDGDTLLRFLPSYQAVEYMRGGDDPARACQKVISRIQKYYPKFFGAVICANVTGSYGAACNRLPTFTQFSFMVYNSLHNQAIEEKVDCM hide sequence

Ensembl Acc Id:

ENSRNOP00000000120 ⟸ ENSRNOT00000000120

RefSeq Acc Id:	XP_038950351 ⟸ XM_039094423
- Peptide Label:	isoform X3
- UniProtKB:	A6JPI5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038950352 ⟸ XM_039094424
- Peptide Label:	isoform X3
- UniProtKB:	A6JPI5 (UniProtKB/TrEMBL)

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P30919-F1-model_v2	AlphaFold	P30919	1-345	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13700085

Promoter ID:

EPDNEW_R10609

Type:

multiple initiation site

Name:

Aga_1

Description:

aspartylglucosaminidase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	41,234,103 - 41,234,163	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-11453	BioCyc
BioCyc Pathway	ASPARAGINE-DEG1-PWY-1 [L-asparagine degradation III (mammalian)]	BioCyc
BioCyc Pathway Image	ASPARAGINE-DEG1-PWY-1	BioCyc
Ensembl Genes	ENSRNOG00000000108	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000000120	ENTREZGENE
	ENSRNOT00000000120.4	UniProtKB/Swiss-Prot
	ENSRNOT00000107358	ENTREZGENE
	ENSRNOT00000116014	ENTREZGENE
Gene3D-CATH	(Glycosyl)asparaginase	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7366394	IMAGE-MGC_LOAD
InterPro	Ntn_hydrolases_N	UniProtKB/Swiss-Prot
	Peptidase_T2	UniProtKB/Swiss-Prot
KEGG Report	rno:290923	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:112709	IMAGE-MGC_LOAD
NCBI Gene	290923	ENTREZGENE
PANTHER	N(4)-(BETA-N-ACETYLGLUCOSAMINYL)-L-ASPARAGINASE	UniProtKB/Swiss-Prot
	PTHR10188	UniProtKB/Swiss-Prot
Pfam	Asparaginase_2	UniProtKB/Swiss-Prot
PhenoGen	Aga	PhenoGen
RatGTEx	ENSRNOG00000000108	RatGTEx
Superfamily-SCOP	SSF56235	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZKU5	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AL08	ENTREZGENE, UniProtKB/TrEMBL
	A6JPI3_RAT	UniProtKB/TrEMBL
	A6JPI4	ENTREZGENE, UniProtKB/TrEMBL
	A6JPI5	ENTREZGENE, UniProtKB/TrEMBL
	ASPG_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q4G065	ENTREZGENE
UniProt Secondary	Q4G065	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Aga	aspartylglucosaminidase	Aga_predicted	aspartylglucosaminidase (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Aga_predicted	aspartylglucosaminidase (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

BioCyc Pathways