Advanced Search (OLGA)

Gene: Gja10 (gap junction protein, alpha 10) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Gja10

Name:

gap junction protein, alpha 10

RGD ID:

1309630

Description:

Predicted to enable gap junction channel activity. Predicted to be involved in cell-cell signaling. Predicted to act upstream of or within detection of light stimulus involved in visual perception; gamete generation; and synapse assembly. Predicted to be located in gap junction. Predicted to be part of connexin complex. Orthologous to human GJA10 (gap junction protein alpha 10); INTERACTS WITH ammonium chloride; bisphenol A; Cuprizon.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

connexin 57; connexin n; Cx-57; Cx57; Cxnn; gap junction membrane channel protein alpha 10; LOC313126; RGD1309630; similar to connexin 57

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GJA10 (gap junction protein alpha 10)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Gja10 (gap junction protein, alpha 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gja10 (gap junction protein alpha 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GJA10 (gap junction protein alpha 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GJA10 (gap junction protein alpha 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gja10 (gap junction protein alpha 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GJA10 (gap junction protein alpha 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GJA10 (gap junction protein alpha 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gja10 (gap junction protein alpha 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GJA9 (gap junction protein alpha 9)	HGNC	OrthoDB
Alliance orthologs ³
Mus musculus (house mouse):	Gja10 (gap junction protein, alpha 10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GJA10 (gap junction protein alpha 10)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cx52.7 (connexin 52.7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cx52.6 (connexin 52.6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gja10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	51,787,407 - 51,799,827 (-)	NCBI		GRCr8
mRatBN7.2	5	46,991,051 - 47,002,902 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	46,992,946 - 46,996,570 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	49,137,140 - 49,138,660 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	50,736,302 - 50,737,822 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	50,681,456 - 50,682,976 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	47,819,484 - 47,841,138 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	47,835,066 - 47,836,586 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	52,423,308 - 52,434,869 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	48,900,601 - 48,902,121 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	48,900,779 - 48,920,511 (-)	NCBI
Celera	5	45,756,256 - 45,757,776 (-)	NCBI		Celera
Cytogenetic Map	5	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gja10	Rat	aflatoxin B1	decreases methylation	ISO	GJA10 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of GJA10 gene	CTD	PMID:27153756
Gja10	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of GJA10 mRNA	CTD	PMID:16483693
Gja10	Rat	aristolochic acid A	increases expression	ISO	GJA10 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of GJA10 mRNA	CTD	PMID:33212167
Gja10	Rat	benzo[a]pyrene	decreases methylation	ISO	GJA10 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of GJA10 promoter	CTD	PMID:27901495
Gja10	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of GJA10 mRNA	CTD	PMID:25181051
Gja10	Rat	CGP 52608	multiple interactions	ISO	GJA10 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to GJA10 gene]	CTD	PMID:28238834
Gja10	Rat	chlorpyrifos	increases expression	ISO	Gja10 (Mus musculus)	6480464	Chlorpyrifos results in increased expression of GJA10 mRNA	CTD	PMID:32715474
Gja10	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of GJA10 mRNA	CTD	PMID:27523638
Gja10	Rat	paracetamol	affects expression	ISO	Gja10 (Mus musculus)	6480464	Acetaminophen affects the expression of GJA9 mRNA	CTD	PMID:17562736
Gja10	Rat	perfluorohexanesulfonic acid	decreases expression	ISO	GJA10 (Homo sapiens)	6480464	perfluorohexanesulfonic acid results in decreased expression of GJA10 mRNA	CTD	PMID:25812627
Gja10	Rat	perfluorononanoic acid	decreases expression	ISO	GJA10 (Homo sapiens)	6480464	perfluoro-n-nonanoic acid results in decreased expression of GJA10 mRNA	CTD	PMID:25812627
Gja10	Rat	perfluorooctane-1-sulfonic acid	decreases expression	ISO	GJA10 (Homo sapiens)	6480464	perfluorooctane sulfonic acid results in decreased expression of GJA10 mRNA	CTD	PMID:25812627
Gja10	Rat	perfluorooctanoic acid	decreases expression	ISO	GJA10 (Homo sapiens)	6480464	perfluorooctanoic acid results in decreased expression of GJA10 mRNA	CTD	PMID:25812627
Gja10	Rat	permethrin	decreases expression	ISO	GJA10 (Homo sapiens)	6480464	Permethrin results in decreased expression of GJA10 mRNA	CTD	PMID:37047231
Gja10	Rat	resveratrol	multiple interactions	ISO	GJA10 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of GJA10 mRNA	CTD	PMID:23557933
Gja10	Rat	Testosterone propionate	increases expression	ISO	Gja10 (Mus musculus)	6480464	Testosterone Propionate results in increased expression of GJA9 mRNA	CTD	PMID:15601916
Gja10	Rat	titanium dioxide	affects expression	ISO	Gja10 (Mus musculus)	6480464	titanium dioxide affects the expression of GJA10 mRNA	CTD	PMID:29264374
Gja10	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of GJA10 mRNA	CTD	PMID:33387578
Gja10	Rat	triptonide	increases expression	ISO	Gja10 (Mus musculus)	6480464	triptonide results in increased expression of GJA10 mRNA	CTD	PMID:33045310

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gja10	Rat	cell communication	involved_in	IEA	InterPro:IPR000500 and InterPro:IPR017990	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gja10	Rat	cell-cell signaling	involved_in	IBA	MGI:1334209 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gja10	Rat	detection of light stimulus involved in visual perception	acts_upstream_of_or_within	ISO	Gja10 (Mus musculus)	1624291	MGI:3043946 PMID:16820008	RGD	PMID:16820008
Gja10	Rat	detection of light stimulus involved in visual perception	acts_upstream_of_or_within	IEA	UniProtKB:Q9WUS4 and ensembl:ENSMUSP00000061742	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gja10	Rat	gamete generation	acts_upstream_of_or_within	ISO	Gja10 (Mus musculus)	1624291	PMID:10329667	RGD	PMID:10329667
Gja10	Rat	gamete generation	acts_upstream_of_or_within	IEA	UniProtKB:Q9WUS4 and ensembl:ENSMUSP00000061742	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gja10	Rat	response to light stimulus	acts_upstream_of_or_within	ISO	Gja10 (Mus musculus)	1624291	MGI:3043946 PMID:16820008	RGD	PMID:16820008
Gja10	Rat	response to light stimulus	acts_upstream_of_or_within	IEA	UniProtKB:Q9WUS4 and ensembl:ENSMUSP00000061742	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gja10	Rat	synapse assembly	acts_upstream_of_or_within	ISO	Gja10 (Mus musculus)	1624291	MGI:3043946 PMID:16820008	RGD	PMID:16820008
Gja10	Rat	synapse assembly	acts_upstream_of_or_within	IEA	UniProtKB:Q9WUS4 and ensembl:ENSMUSP00000061742	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gja10	Rat	transmembrane transport	involved_in	IEA	GO:0005243	1600115	GO_REF:0000108	GOC	GO_REF:0000108

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gja10	Rat	anchoring junction	located_in	IEA	UniProtKB-KW:KW-0965	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gja10	Rat	connexin complex	part_of	IBA	MGI:2384150 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gja10	Rat	connexin complex	part_of	IEA	InterPro:IPR000500 and InterPro:IPR017990	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gja10	Rat	gap junction	located_in	IEA	UniProtKB:Q9WUS4 and ensembl:ENSMUSP00000061742	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gja10	Rat	gap junction	located_in	IEA	UniProtKB-KW:KW-0303	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gja10	Rat	gap junction	located_in	IEA	UniProtKB-SubCell:SL-0124	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Gja10	Rat	gap junction	located_in	ISO	Gja10 (Mus musculus)	1624291	PMID:10329667	RGD	PMID:10329667
Gja10	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gja10	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Gja10	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gja10	Rat	gap junction channel activity	enables	IBA	MGI:1339969 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gja10	Rat	gap junction channel activity	enables	ISO	Gja10 (Mus musculus)	1624291	PMID:10329667	RGD	PMID:10329667
Gja10	Rat	gap junction channel activity	enables	IEA	UniProtKB:Q9WUS4 and ensembl:ENSMUSP00000061742	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Functional expression of connexin57 in horizontal cells of the mouse retina.	Hombach S, etal., Eur J Neurosci. 2004 May;19(10):2633-40.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:10329667	PMID:16194882	PMID:16820008

Gja10
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	51,787,407 - 51,799,827 (-)	NCBI		GRCr8
mRatBN7.2	5	46,991,051 - 47,002,902 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	46,992,946 - 46,996,570 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	49,137,140 - 49,138,660 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	50,736,302 - 50,737,822 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	50,681,456 - 50,682,976 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	47,819,484 - 47,841,138 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	47,835,066 - 47,836,586 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	52,423,308 - 52,434,869 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	48,900,601 - 48,902,121 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	48,900,779 - 48,920,511 (-)	NCBI
Celera	5	45,756,256 - 45,757,776 (-)	NCBI		Celera
Cytogenetic Map	5	q21	NCBI

GJA10
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	89,894,469 - 89,896,120 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	89,894,469 - 89,921,760 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	90,604,188 - 90,605,839 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	90,660,909 - 90,662,540 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	6	91,024,729 - 91,026,360 (+)	NCBI		Celera
Cytogenetic Map	6	q15	NCBI
HuRef	6	87,823,568 - 87,825,199 (+)	NCBI		HuRef
CHM1_1	6	90,701,849 - 90,703,480 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	91,106,163 - 91,107,814 (+)	NCBI		T2T-CHM13v2.0

Gja10
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	32,594,595 - 32,607,382 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	32,596,960 - 32,602,760 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	32,600,865 - 32,602,382 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	32,596,960 - 32,602,760 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	32,687,840 - 32,689,357 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	32,929,478 - 32,930,995 (-)	NCBI		MGSCv36	mm8
Celera	4	32,348,089 - 32,349,606 (-)	NCBI		Celera
Cytogenetic Map	4	A5	NCBI
cM Map	4	14.25	NCBI

Gja10
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955411	16,593,576 - 16,595,042 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955411	16,586,673 - 16,601,999 (+)	NCBI	ChiLan1.0	ChiLan1.0

GJA10
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	109,979,746 - 109,981,397 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	107,880,882 - 107,882,533 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	87,774,889 - 87,776,520 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	91,046,601 - 91,048,232 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	91,046,601 - 91,072,335 (+)	Ensembl	panpan1.1		panPan2

GJA10
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	49,075,169 - 49,099,146 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	49,092,747 - 49,097,743 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	48,881,931 - 48,905,866 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	49,884,482 - 49,908,390 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	49,902,078 - 49,907,050 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	49,199,389 - 49,223,286 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	49,100,131 - 49,124,052 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	49,292,484 - 49,316,411 (+)	NCBI		UU_Cfam_GSD_1.0

Gja10
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	84,077,686 - 84,079,313 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936510	2,379,892 - 2,395,851 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936510	2,380,114 - 2,395,781 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GJA10
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	57,868,387 - 57,893,687 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	57,879,740 - 57,881,395 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	64,826,657 - 64,828,312 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GJA10
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	14,646,091 - 14,716,787 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	14,651,295 - 14,652,926 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	191,033,170 - 191,041,842 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gja10
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624799	4,278,097 - 4,279,588 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Gja10
95 total Variants

Assembly: Rnor_6.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
5	47836210	47836211	T	C	snv	CDR, SBH/Ygl (RGD), SBH/Ygl (MCW)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	81
Count of miRNA genes:	71
Interacting mature miRNAs:	74
Transcripts:	ENSRNOT00000008469
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293666	Bmd38	Bone mineral density QTL 38	4.4		femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	5	8948228	53948228	Rat
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	27955440	72955440	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	18873947	74251464	Rat
1300117	Hrtrt8	Heart rate QTL 8	3.49		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	3844018	47869213	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	28515489	73515489	Rat
61462	Niddm10	Non-insulin dependent diabetes mellitus QTL 10	3.9	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	5	5112159	47171491	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	27955440	72955440	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	35189153	68564008	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	28515489	73515489	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
1641903	Alcrsp3	Alcohol response QTL 3			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	12689285	57689285	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	21226744	66226744	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	18873947	63873947	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
1	5	26	24	22	17	9	17	2	46	17	21	11	43	5


RefSeq Transcripts	NM_001411855	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008763619	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593350	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_001837840	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY233217	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY834201	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LT990406	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000008469 ⟹ ENSRNOP00000008469

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	46,992,946 - 46,996,570 (-)	Ensembl
Rnor_6.0 Ensembl	5	47,835,066 - 47,836,586 (-)	Ensembl

RefSeq Acc Id:

NM_001411855 ⟹ NP_001398784

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	51,787,407 - 51,797,913 (-)	NCBI
mRatBN7.2	5	46,991,051 - 47,001,555 (-)	NCBI

RefSeq Acc Id:

XM_008763619 ⟹ XP_008761841

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	51,791,402 - 51,799,827 (-)	NCBI
mRatBN7.2	5	46,994,964 - 47,002,902 (-)	NCBI
Rnor_6.0	5	47,835,066 - 47,841,138 (-)	NCBI

Sequence:

show sequence

TGTATAAGTGTTGATCCTGCCTTGCAGATGCTTCGCATTTTAGCACGGCATAGCTTTAGGTCTGATTGTCACTCCACTCATTTTTGCTCACATTTGATGAGGCCAGATTCACCCCAGGCAGCTATGAA
ACTGGACACGGCTTATTGATCTGCGAGTGTTGATTTCCAGAGCAATCAATGAACTACAGAAATATACTCAACTCAAATCAAATTCACAAACAAAAAGTGACGACTATTATCTGTTTTACTCTTTGTTT
CCGAATGAGGTCTACCAGAAGGTGTCCTAACATGGTATCAACTAAACAAATGCTACAAGAAAGTCGCAGATTAGCAAAGGACAGTTTTAGTTGGAGGATGGGAGTGGCAACTAGGTCAGACTACATTG
ATGGAAACTGCCGTGTTCATTTTGAATTAGAGCCCCACAGCCACCTGACCGGAGCCTTTGTACCAGCAGGCAGCAGCAGAAGCAGCTGTTCTGTTAAACAGCCACACATGGTGCAACTTGAAGGTCCT
GCAAACTCCAGTGGAATTTTCTGGTCTGACTTTAAGATGTGAAATCCTCGCCATGGGAGATTGGAATTTACTGGGTGGCATCCTAGAGGAAGTCCACTCCCACTCCACTATAGTGGGGAAAATCTGGC
TGACTATCCTCTTCATCTTCCGAATGCTGGTACTTGGTGTTGCTGCTGAGGATGTCTGGGATGACGAGCAGTCCTCCTTTGCCTGCAACACCCAGCAGCCTGGTTGCAGCAATATCTGTTATGATGAT
GCTTTCCCTATCTCTCTGATCAGATTCTGGGTTTTGCAGATCATCTTTGTGTCTTCCCCTTCTTTGGTGTATATGGGCCATGCACTCTATAGACTCAGGGACTTTGAGAAACAAAGGCAGAAGAAGAA
GTTATACCTCAAAGCCCAGATGGAGAACCCAGATCTTGACTTGGAGGAGCAACAAAGGGTTGAGAGGGAGCTGAGGAGACTCGAGGAGCAGAAGAGGATTCAAAAAGTCCCTCTGAAAGGGTGTCTCC
TGCGCACCTACGTCTTACACATCTTGACCAGATCTGTGCTAGAGGTAGGGTTCATGATAGGCCAATATATTCTCTATGGGTTCCAAATGCACCCTATTTACAAGTGCACACAAGCCCCTTGCCCCAAC
GCAGTGGACTGCTTTGTATCCAGGCCCACAGAGAAGACCATTTTCATGCTCTTTATGCACAGCATTGCAGCCATCTCCTTGTTACTCAATATTCTGGAGATATTTCATCTCGGCATCAGGAAGATCAT
GAGGGCACTCGATGGCAAATCCAGCAGTGGGAACACTGAGAATGAAACAGGCCCTCCGTTCCATTCAACCAACTACTCAGGGGCCCAGCAGTGTATGGTTTGTTCTTCTTTACCTGAAAGAGTCTCAC
TACTTCAAGCCAACAATAAACAGCAAGTCATCCGTGTCAACATACCAAGGTCTAAAAGCGTGTGGCAAATTCCACATCCCAGGCAACTTGAGGTAGATGTTTCCTGTGGCAAAAGAGGCTGGGCTGAG
AGAGTTGAGAACAGTGAACAGCTCCATGTCCATAGTCCATGTCCACATGAGCGCAGCGCCAGAATTCAGCACCCGGGACAGCAACCATGCCATTCCATCGTTTGCCCCAAGAATGTAATGTCTCAGTC
CTGGTTAGGTACAATGACAGCTTCTCAACACCGTCCATCATCTGCGTTAGAAACCTGGGAGCGATCCCAGGGCCCAGAAGTTTCAGGGAAACCTCTCACAGATCGCCAGAGTCACTTCCAAGGCAGCG
ATGGCAGTGCAAGAGAGAGTGGGGTATGGACAGACAGATTAGGCCCAGGTAGTCGCAAGGCCAGCTTTCTATCGAGGCTGATATCAGAAAAGGGACAACAGCATAGTGACTCAGGAAGCTCGAGGTCT
CTGAATAGCTCCTGCTTGGATTTTCCACATGGGGAAAACAGCCCATCACCTCTGCCATCAGCCACTGGGCACAGAGCATCGATGGTAAGTAAAAGCAGCCATGTTGATTCACCCTCTGTCTCTTCTCC
TTTTATCATATGTGGGACATATGTATATGTGTATTAA

hide sequence


Protein RefSeqs	NP_001398784	(Get FASTA)	NCBI Sequence Viewer
	XP_008761841	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAP04734	(Get FASTA)	NCBI Sequence Viewer
	AAW38940	(Get FASTA)	NCBI Sequence Viewer
	EDL98564	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000008469.5
	ENSRNOP00000100100
GenBank Protein	VZP20206	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	XP_008761841 ⟸ XM_008763619
- Peptide Label:	isoform X1
- UniProtKB:	A0A654ID08 (UniProtKB/TrEMBL), Q80XY0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGDWNLLGGILEEVHSHSTIVGKIWLTILFIFRMLVLGVAAEDVWDDEQSSFACNTQQPGCSNICYDDAFPISLIRFWVLQIIFVSSPSLVYMGHALYRLRDFEKQRQKKKLYLKAQMENPDLDLEEQ QRVERELRRLEEQKRIQKVPLKGCLLRTYVLHILTRSVLEVGFMIGQYILYGFQMHPIYKCTQAPCPNAVDCFVSRPTEKTIFMLFMHSIAAISLLLNILEIFHLGIRKIMRALDGKSSSGNTENETG PPFHSTNYSGAQQCMVCSSLPERVSLLQANNKQQVIRVNIPRSKSVWQIPHPRQLEVDVSCGKRGWAERVENSEQLHVHSPCPHERSARIQHPGQQPCHSIVCPKNVMSQSWLGTMTASQHRPSSALE TWERSQGPEVSGKPLTDRQSHFQGSDGSARESGVWTDRLGPGSRKASFLSRLISEKGQQHSDSGSSRSLNSSCLDFPHGENSPSPLPSATGHRASMVSKSSHVDSPSVSSPFIICGTYVYVY hide sequence

Ensembl Acc Id:

ENSRNOP00000008469 ⟸ ENSRNOT00000008469

RefSeq Acc Id:	NP_001398784 ⟸ NM_001411855
- Peptide Label:	precursor
- UniProtKB:	F1LPI3 (UniProtKB/TrEMBL), Q80XY0 (UniProtKB/TrEMBL)

Protein Domains

Connexin N-terminal Gap junction protein cysteine-rich

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LPI3-F1-model_v2	AlphaFold	F1LPI3	1-506	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-41718	BioCyc
Ensembl Genes	ENSRNOG00000006478	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000008469.6	UniProtKB/TrEMBL
	ENSRNOT00000159977	ENTREZGENE
Gene3D-CATH	1.20.1440.80	UniProtKB/TrEMBL
InterPro	Connexin	UniProtKB/TrEMBL
	Connexin_CCC	UniProtKB/TrEMBL
	Connexin_CS	UniProtKB/TrEMBL
	Connexin_N	UniProtKB/TrEMBL
	Connexin_N_sf	UniProtKB/TrEMBL
NCBI Gene	313126	ENTREZGENE
PANTHER	Connexin	UniProtKB/TrEMBL
	GAP JUNCTION ALPHA-10 PROTEIN	UniProtKB/TrEMBL
Pfam	Connexin	UniProtKB/TrEMBL
PhenoGen	Gja10	PhenoGen
PRINTS	CONNEXIN	UniProtKB/TrEMBL
PROSITE	CONNEXINS_1	UniProtKB/TrEMBL
	CONNEXINS_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000006478	RatGTEx
SMART	CNX	UniProtKB/TrEMBL
	Connexin_CCC	UniProtKB/TrEMBL
UniProt	A0A654ID08	ENTREZGENE, UniProtKB/TrEMBL
	F1LPI3	ENTREZGENE, UniProtKB/TrEMBL
	Q80XY0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-05-20	Gja10	gap junction protein, alpha 10	Gja10	gap junction membrane channel protein alpha 10	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Gja10	gap junction membrane channel protein alpha 10	Gja10_predicted	gap junction membrane channel protein alpha 10 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-03-11	Gja10_predicted	gap junction membrane channel protein alpha 10 (predicted)	RGD1309630_predicted	similar to connexin 57 (predicted)	Symbol and Name status set to approved	1299863	APPROVED
2005-01-20	RGD1309630_predicted	similar to connexin 57 (predicted)	LOC313126_predicted		Symbol updated	1331353	APPROVED
2005-01-12	LOC313126_predicted	similar to connexin 57 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message