Advanced Search (OLGA)

Gene: Mrps14 (mitochondrial ribosomal protein S14) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Mrps14

Name:

mitochondrial ribosomal protein S14

RGD ID:

1309432

Description:

Predicted to be a structural constituent of ribosome. Predicted to be involved in mitochondrial translation. Predicted to be located in mitochondrion and nuclear membrane. Predicted to be part of mitochondrial small ribosomal subunit. Human ortholog(s) of this gene implicated in combined oxidative phosphorylation deficiency 38. Orthologous to human MRPS14 (mitochondrial ribosomal protein S14); INTERACTS WITH 2,4-dinitrotoluene; 2,6-dinitrotoluene; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

28S ribosomal protein S14, mitochondrial; LOC289143; small ribosomal subunit protein uS14m

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MRPS14 (mitochondrial ribosomal protein S14)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Mrps14 (mitochondrial ribosomal protein S14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mrps14 (mitochondrial ribosomal protein S14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MRPS14 (mitochondrial ribosomal protein S14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MRPS14 (mitochondrial ribosomal protein S14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mrps14 (mitochondrial ribosomal protein S14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MRPS14 (mitochondrial ribosomal protein S14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MRPS14 (mitochondrial ribosomal protein S14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mrps14 (mitochondrial ribosomal protein S14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SHISA4 (shisa family member 4)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	MRPS14 (mitochondrial ribosomal protein S14)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mrps14 (mitochondrial ribosomal protein S14)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mrps14 (mitochondrial ribosomal protein S14)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	MRP2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	mRpS14	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mrps-14	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	mrps14	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	74,962,597 - 74,968,344 (+)	NCBI		GRCr8
mRatBN7.2	13	72,429,168 - 72,434,915 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	72,408,558 - 72,434,915 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	75,013,704 - 75,019,477 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	76,306,228 - 76,311,975 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	73,565,777 - 73,571,524 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	77,940,454 - 77,946,201 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	77,940,454 - 77,946,201 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	82,847,625 - 82,853,372 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	75,614,841 - 75,620,588 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	75,629,051 - 75,634,776 (+)	NCBI
Celera	13	72,234,949 - 72,240,696 (+)	NCBI		Celera
Cytogenetic Map	13	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mrps14	Rat	1q24 Deletion Syndrome		ISO	MRPS14 (Homo sapiens)	8554872	ClinVar Annotator: match by term: 1q24q25 microdeletion syndrome	ClinVar	PMID:21548129 more ...
Mrps14	Rat	antithrombin III deficiency		ISO	MRPS14 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary antithrombin deficiency	ClinVar
Mrps14	Rat	combined oxidative phosphorylation deficiency 38		ISO	MRPS14 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:25741868 more ...
Mrps14	Rat	gastrointestinal stromal tumor		ISO	MRPS14 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Gastrointestinal stromal tumor	ClinVar	PMID:28492532
Mrps14	Rat	parathyroid carcinoma		ISO	MRPS14 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Parathyroid carcinoma	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mrps14	Rat	combined oxidative phosphorylation deficiency 38		ISO	MRPS14 (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mrps14	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Mrps14 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of MRPS14 mRNA	CTD	PMID:36331819
Mrps14	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Mrps14 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of MRPS14 mRNA	CTD	PMID:22206623
Mrps14	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	Mrps14 (Mus musculus)	6480464	[Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of MRPS14 mRNA	CTD	PMID:37844793
Mrps14	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of MRPS14 mRNA	CTD	PMID:21346803
Mrps14	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of MRPS14 mRNA	CTD	PMID:21346803
Mrps14	Rat	2-hydroxypropanoic acid	decreases expression	ISO	MRPS14 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of MRPS14 mRNA	CTD	PMID:30851411
Mrps14	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	MRPS14 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MRPS14 mRNA	CTD	PMID:28628672
Mrps14	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Mrps14 (Mus musculus)	6480464	bisphenol S results in increased expression of MRPS14 mRNA	CTD	PMID:39298647
Mrps14	Rat	aristolochic acid A	decreases expression	ISO	MRPS14 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of MRPS14 mRNA	CTD	PMID:33212167
Mrps14	Rat	atrazine	decreases expression	ISO	MRPS14 (Homo sapiens)	6480464	Atrazine results in decreased expression of MRPS14 mRNA	CTD	PMID:22378314
Mrps14	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	Mrps14 (Mus musculus)	6480464	Diethylhexyl Phthalate results in decreased expression of MRPS14 mRNA	CTD	PMID:35550907
Mrps14	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Mrps14 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of MRPS14 mRNA	CTD	PMID:33754040
Mrps14	Rat	bisphenol A	increases expression	ISO	MRPS14 (Homo sapiens)	6480464	bisphenol A results in increased expression of MRPS14 mRNA	CTD	PMID:20678512
Mrps14	Rat	bisphenol A	increases expression	ISO	Mrps14 (Mus musculus)	6480464	bisphenol A results in increased expression of MRPS14 mRNA	CTD	PMID:33221593
Mrps14	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of MRPS14 mRNA	CTD	PMID:25181051
Mrps14	Rat	bisphenol F	multiple interactions	ISO	MRPS14 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MRPS14 mRNA	CTD	PMID:28628672
Mrps14	Rat	cadmium atom	increases expression	ISO	MRPS14 (Homo sapiens)	6480464	Cadmium results in increased expression of MRPS14 mRNA	CTD	PMID:24376830
Mrps14	Rat	carbamazepine	affects expression	ISO	MRPS14 (Homo sapiens)	6480464	Carbamazepine affects the expression of MRPS14 mRNA	CTD	PMID:25979313
Mrps14	Rat	chlormequat chloride	increases expression	EXP		6480464	Chlormequat results in increased expression of MRPS14 protein	CTD	PMID:34958886
Mrps14	Rat	chlorpyrifos	increases expression	ISO	Mrps14 (Mus musculus)	6480464	Chlorpyrifos results in increased expression of MRPS14 mRNA	CTD	PMID:37019170
Mrps14	Rat	clobetasol	increases expression	ISO	Mrps14 (Mus musculus)	6480464	Clobetasol results in increased expression of MRPS14 mRNA	CTD	PMID:27462272
Mrps14	Rat	cobalt dichloride	decreases expression	ISO	MRPS14 (Homo sapiens)	6480464	cobaltous chloride results in decreased expression of MRPS14 mRNA	CTD	PMID:19376846
Mrps14	Rat	copper(II) sulfate	decreases expression	ISO	MRPS14 (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of MRPS14 mRNA	CTD	PMID:19549813
Mrps14	Rat	dexamethasone	multiple interactions	ISO	MRPS14 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MRPS14 mRNA	CTD	PMID:28628672
Mrps14	Rat	Dibutyl phosphate	affects expression	ISO	MRPS14 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of MRPS14 mRNA	CTD	PMID:37042841
Mrps14	Rat	diclofenac	multiple interactions	ISO	Mrps14 (Mus musculus)	6480464	[Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of MRPS14 mRNA	CTD	PMID:37844793
Mrps14	Rat	dicrotophos	decreases expression	ISO	MRPS14 (Homo sapiens)	6480464	dicrotophos results in decreased expression of MRPS14 mRNA	CTD	PMID:28302478
Mrps14	Rat	dorsomorphin	multiple interactions	ISO	MRPS14 (Homo sapiens)	6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MRPS14 mRNA	CTD	PMID:27188386
Mrps14	Rat	endosulfan	decreases expression	EXP		6480464	Endosulfan results in decreased expression of MRPS14 mRNA	CTD	PMID:29391264
Mrps14	Rat	enzyme inhibitor	multiple interactions	ISO	MRPS14 (Homo sapiens)	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of MRPS14 protein	CTD	PMID:23301498
Mrps14	Rat	epoxiconazole	increases expression	ISO	Mrps14 (Mus musculus)	6480464	epoxiconazole results in increased expression of MRPS14 mRNA	CTD	PMID:35436446
Mrps14	Rat	finasteride	increases expression	EXP		6480464	Finasteride results in increased expression of MRPS14 mRNA	CTD	PMID:24136188
Mrps14	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of MRPS14 mRNA	CTD	PMID:24136188
Mrps14	Rat	hydrogen peroxide	increases expression	ISO	MRPS14 (Homo sapiens)	6480464	Hydrogen Peroxide results in increased expression of MRPS14 mRNA	CTD	PMID:18951874
Mrps14	Rat	ibuprofen	multiple interactions	ISO	Mrps14 (Mus musculus)	6480464	[Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of MRPS14 mRNA	CTD	PMID:37844793
Mrps14	Rat	indometacin	multiple interactions	ISO	MRPS14 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MRPS14 mRNA	CTD	PMID:28628672
Mrps14	Rat	inulin	multiple interactions	ISO	Mrps14 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of MRPS14 mRNA	CTD	PMID:36331819
Mrps14	Rat	lipopolysaccharide	multiple interactions	ISO	MRPS14 (Homo sapiens)	6480464	[Acetaminophen co-treated with Lipopolysaccharides] results in increased expression of MRPS14 mRNA	CTD	PMID:31059760
Mrps14	Rat	methylmercury chloride	decreases expression	ISO	MRPS14 (Homo sapiens)	6480464	methylmercuric chloride results in decreased expression of MRPS14 mRNA	CTD	PMID:28001369
Mrps14	Rat	miconazole	decreases expression	ISO	Mrps14 (Mus musculus)	6480464	Miconazole results in decreased expression of MRPS14 mRNA	CTD	PMID:27462272
Mrps14	Rat	monosodium L-glutamate	multiple interactions	ISO	Mrps14 (Mus musculus)	6480464	[Trans Fatty Acids co-treated with Sodium Glutamate] results in increased expression of MRPS14 mRNA	CTD	PMID:22078008
Mrps14	Rat	nimesulide	increases expression	EXP		6480464	nimesulide results in increased expression of MRPS14 mRNA	CTD	PMID:24136188
Mrps14	Rat	ozone	multiple interactions	ISO	MRPS14 (Homo sapiens)	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of MRPS14 mRNA	CTD	PMID:35430440
Mrps14	Rat	p-chloromercuribenzoic acid	decreases expression	ISO	MRPS14 (Homo sapiens)	6480464	p-Chloromercuribenzoic Acid results in decreased expression of MRPS14 mRNA	CTD	PMID:26272509
Mrps14	Rat	p-chloromercuribenzoic acid	multiple interactions	ISO	MRPS14 (Homo sapiens)	6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MRPS14 mRNA	CTD	PMID:27188386
Mrps14	Rat	paracetamol	affects expression	ISO	Mrps14 (Mus musculus)	6480464	Acetaminophen affects the expression of MRPS14 mRNA	CTD	PMID:17562736
Mrps14	Rat	paracetamol	increases expression	ISO	MRPS14 (Homo sapiens)	6480464	Acetaminophen results in increased expression of MRPS14 mRNA	CTD	PMID:31059760
Mrps14	Rat	paracetamol	multiple interactions	ISO	MRPS14 (Homo sapiens)	6480464	[Acetaminophen co-treated with Lipopolysaccharides] results in increased expression of MRPS14 mRNA	CTD	PMID:31059760
Mrps14	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Mrps14 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of MRPS14 mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of MRPS14 mRNA	CTD	PMID:36331819
Mrps14	Rat	pregnenolone 16alpha-carbonitrile	increases expression	EXP		6480464	Pregnenolone Carbonitrile results in increased expression of MRPS14 mRNA	CTD	PMID:19162173
Mrps14	Rat	pyrazinecarboxamide	decreases expression	EXP		6480464	Pyrazinamide results in decreased expression of MRPS14 mRNA	CTD	PMID:22431067
Mrps14	Rat	rac-lactic acid	decreases expression	ISO	MRPS14 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of MRPS14 mRNA	CTD	PMID:30851411
Mrps14	Rat	resveratrol	multiple interactions	ISO	MRPS14 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of MRPS14 mRNA	CTD	PMID:23557933
Mrps14	Rat	SB 431542	multiple interactions	ISO	MRPS14 (Homo sapiens)	6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MRPS14 mRNA	CTD	PMID:27188386
Mrps14	Rat	sodium arsenite	decreases expression	ISO	MRPS14 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of MRPS14 mRNA	CTD	PMID:38568856
Mrps14	Rat	Soman	decreases expression	EXP		6480464	Soman results in decreased expression of MRPS14 mRNA	CTD	PMID:19281266
Mrps14	Rat	sulindac	decreases expression	EXP		6480464	Sulindac results in decreased expression of MRPS14 mRNA	CTD	PMID:24136188
Mrps14	Rat	tert-butyl hydroperoxide	decreases expression	ISO	MRPS14 (Homo sapiens)	6480464	tert-Butylhydroperoxide results in decreased expression of MRPS14 mRNA	CTD	PMID:15336504
Mrps14	Rat	thiram	decreases expression	ISO	MRPS14 (Homo sapiens)	6480464	Thiram results in decreased expression of MRPS14 mRNA	CTD	PMID:38568856
Mrps14	Rat	titanium dioxide	decreases methylation	ISO	Mrps14 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of MRPS14 promoter	CTD	PMID:35295148
Mrps14	Rat	titanium dioxide	increases methylation	ISO	Mrps14 (Mus musculus)	6480464	titanium dioxide results in increased methylation of MRPS14 promoter	CTD	PMID:35295148
Mrps14	Rat	tolcapone	decreases expression	EXP		6480464	tolcapone results in decreased expression of MRPS14 mRNA	CTD	PMID:24136188
Mrps14	Rat	trichostatin A	increases expression	ISO	MRPS14 (Homo sapiens)	6480464	trichostatin A results in increased expression of MRPS14 mRNA	CTD	PMID:24935251
Mrps14	Rat	triphenyl phosphate	affects expression	ISO	MRPS14 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of MRPS14 mRNA	CTD	PMID:37042841
Mrps14	Rat	tungsten	increases expression	ISO	Mrps14 (Mus musculus)	6480464	Tungsten results in increased expression of MRPS14 mRNA	CTD	PMID:30912803
Mrps14	Rat	valproic acid	affects expression	ISO	MRPS14 (Homo sapiens)	6480464	Valproic Acid affects the expression of MRPS14 mRNA	CTD	PMID:25979313
Mrps14	Rat	valproic acid	increases expression	ISO	MRPS14 (Homo sapiens)	6480464	Valproic Acid results in increased expression of MRPS14 mRNA	CTD	PMID:24935251
Mrps14	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of MRPS14 mRNA	CTD	PMID:23869203
Mrps14	Rat	vinclozolin	decreases expression	EXP		6480464	vinclozolin results in decreased expression of MRPS14 mRNA	CTD	PMID:23034163

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mrps14	Rat	mitochondrial translation	involved_in	ISO	MRPS14 (Homo sapiens)	1624291	PMID:30358850	RGD	PMID:30358850
Mrps14	Rat	mitochondrial translation	involved_in	IEA	UniProtKB:O60783 and ensembl:ENSP00000420714	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mrps14	Rat	translation	involved_in	IBA	PANTHER:PTN000457003 and UniProtKB:O60783	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mrps14	Rat	translation	involved_in	IEA	InterPro:IPR001209	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mrps14	Rat	cytoplasm	located_in	IEA	ARBA:ARBA00026971	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Mrps14	Rat	mitochondrial small ribosomal subunit	part_of	ISO	MRPS14 (Homo sapiens)	1624291	PMID:25838379	RGD	PMID:25838379
Mrps14	Rat	mitochondrial small ribosomal subunit	part_of	IEA	UniProtKB:O60783 and ensembl:ENSP00000420714	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mrps14	Rat	mitochondrial small ribosomal subunit	part_of	IBA	PANTHER:PTN000457005 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mrps14	Rat	mitochondrion	located_in	ISO	MRPS14 (Homo sapiens)	1624291		RGD	GO_REF:0000052
Mrps14	Rat	mitochondrion	located_in	IEA	UniProtKB:O60783 and ensembl:ENSP00000420714	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mrps14	Rat	nuclear membrane	located_in	ISO	MRPS14 (Homo sapiens)	1624291		RGD	GO_REF:0000052
Mrps14	Rat	nuclear membrane	located_in	IEA	UniProtKB:O60783 and ensembl:ENSP00000420714	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mrps14	Rat	ribonucleoprotein complex	part_of	IEA	UniProtKB-KW:KW-0687	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mrps14	Rat	ribosome	located_in	IEA	UniProtKB-KW:KW-0689	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mrps14	Rat	ribosome	located_in	IEA	InterPro:IPR001209	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mrps14	Rat	protein binding	enables	ISO	MRPS14 (Homo sapiens)	1624291	UniProtKB:P06396 more ...	RGD	PMID:32814053
Mrps14	Rat	protein binding	enables	ISO	Mrps14 (Mus musculus)	1624291	UniProtKB:Q810M6 and PMID:25369936	RGD	PMID:25369936
Mrps14	Rat	structural constituent of ribosome	enables	IEA	InterPro:IPR001209	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Mrps14	Rat	structural constituent of ribosome	enables	IBA	PANTHER:PTN000457003 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:14651853	PMID:18614015	PMID:22681889	PMID:25838379	PMID:30358850

Mrps14
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	74,962,597 - 74,968,344 (+)	NCBI		GRCr8
mRatBN7.2	13	72,429,168 - 72,434,915 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	72,408,558 - 72,434,915 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	75,013,704 - 75,019,477 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	76,306,228 - 76,311,975 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	73,565,777 - 73,571,524 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	77,940,454 - 77,946,201 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	77,940,454 - 77,946,201 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	82,847,625 - 82,853,372 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	75,614,841 - 75,620,588 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	75,629,051 - 75,634,776 (+)	NCBI
Celera	13	72,234,949 - 72,240,696 (+)	NCBI		Celera
Cytogenetic Map	13	q22	NCBI

MRPS14
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	175,012,958 - 175,023,425 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	175,010,789 - 175,023,425 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	174,982,094 - 174,992,561 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	173,249,751 - 173,259,184 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	171,714,784 - 171,724,218	NCBI
Celera	1	148,092,797 - 148,102,230 (-)	NCBI		Celera
Cytogenetic Map	1	q25.1	NCBI
HuRef	1	146,208,425 - 146,218,922 (-)	NCBI		HuRef
CHM1_1	1	176,405,063 - 176,415,560 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	174,366,714 - 174,377,180 (-)	NCBI		T2T-CHM13v2.0

Mrps14
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	160,022,785 - 160,028,756 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	160,022,785 - 160,029,740 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	160,195,215 - 160,201,186 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	160,195,215 - 160,202,170 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	162,125,391 - 162,131,317 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	162,031,937 - 162,037,863 (+)	NCBI		MGSCv36	mm8
Celera	1	162,607,096 - 162,612,942 (+)	NCBI		Celera
Cytogenetic Map	1	H2.1	NCBI
cM Map	1	69.59	NCBI

Mrps14
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955406	14,844,301 - 14,847,389 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955406	14,844,301 - 14,847,389 (-)	NCBI	ChiLan1.0	ChiLan1.0

MRPS14
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	74,708,443 - 74,720,406 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	74,382,075 - 74,392,599 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	150,524,532 - 150,535,053 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	154,224,170 - 154,233,193 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	154,222,744 - 154,233,292 (-)	Ensembl	panpan1.1		panPan2

MRPS14
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	24,342,371 - 24,368,519 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	23,868,579 - 23,894,721 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	24,090,104 - 24,116,256 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	24,090,194 - 24,117,251 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	24,002,891 - 24,028,933 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	24,093,887 - 24,120,018 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	24,238,930 - 24,265,074 (+)	NCBI		UU_Cfam_GSD_1.0

Mrps14
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	95,345,293 - 95,349,734 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936481	13,192,021 - 13,195,806 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936481	13,192,030 - 13,195,812 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MRPS14
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	117,097,849 - 117,137,110 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	117,097,841 - 117,137,188 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	128,704,598 - 128,715,495 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MRPS14
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	54,231,605 - 54,240,724 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	54,231,643 - 54,240,472 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666055	55,805,432 - 55,814,579 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mrps14
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624771	6,975,673 - 6,978,290 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624771	6,975,680 - 6,978,290 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Mrps14
22 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	94
Count of miRNA genes:	67
Interacting mature miRNAs:	83
Transcripts:	ENSRNOT00000003460
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	46088046	91088046	Rat
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	34663461	87525369	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	56056920	101056920	Rat
8655951	Rf63	Renal function QTL 63	12.2		blood urea nitrogen amount (VT:0005265)	plasma urea nitrogen level (CMO:0000586)	13	69060519	77046890	Rat
70220	Bp55	Blood pressure QTL 55	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	37374509	82374509	Rat
8655945	Rf61	Renal function QTL 61	3.6		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	13	69060519	86800898	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	46197976	84753113	Rat
4889861	Pur29	Proteinuria QTL 29	13.8	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	37415584	80753406	Rat
1331783	Bp221	Blood pressure QTL 221	3.72886		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	69060519	86800898	Rat
12879441	Bp396	Blood pressure QTL 396			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45699983	90699983	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	65103704	106807694	Rat
1300166	Kidm6	Kidney mass QTL 6	3.93		kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	13	69060519	86800898	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	39754544	84754544	Rat
2303028	Bp329	Blood pressure QTL 329			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	58497872	73485113	Rat
1581570	Eae17	Experimental allergic encephalomyelitis QTL 17	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	13	8897350	101631289	Rat
61340	Bp25	Blood pressure QTL 25	4.2	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	34535218	79535218	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	5994833	77046787	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	38433408	83433408	Rat
724564	Uae11	Urinary albumin excretion QTL 11	5.7		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	13	59492522	77046890	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	20605871	101339738	Rat
7387280	Uae43	Urinary albumin excretion QTL 43	5.69	0.4174	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	66451204	106807694	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	59874408	85581182	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	31241331	93395974	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	65103704	106807694	Rat
61349	Bp31	Blood pressure QTL 31	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	37374509	82374509	Rat
2303563	Bw89	Body weight QTL 89	6		body mass (VT:0001259)	body weight (CMO:0000012)	13	32284471	77284471	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	30395351	101056920	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	5994833	77046787	Rat
12879477	Bp401	Blood pressure QTL 401			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	37262092	82262092	Rat
1331750	Bp220	Blood pressure QTL 220	2.98		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	37415584	82415584	Rat
1641901	Alcrsp6	Alcohol response QTL 6			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	13	52362171	97362171	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	61825626	106807694	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	101056920	Rat

RH141053

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	72,434,595 - 72,434,802 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	77,945,882 - 77,946,088	NCBI	Rnor6.0
Rnor_5.0	13	82,853,053 - 82,853,259	UniSTS	Rnor5.0
RGSC_v3.4	13	75,620,269 - 75,620,475	UniSTS	RGSC3.4
Celera	13	72,240,377 - 72,240,583	UniSTS
Cytogenetic Map	13	q22	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001105963	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006250098	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC166895	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214536	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000003460 ⟹ ENSRNOP00000003460

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	72,430,160 - 72,434,915 (+)	Ensembl
Rnor_6.0 Ensembl	13	77,940,454 - 77,946,201 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076016

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	13	77,945,014 - 77,945,507 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076320

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	72,408,558 - 72,434,902 (+)	Ensembl
Rnor_6.0 Ensembl	13	77,940,814 - 77,945,915 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076539

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	13	77,940,552 - 77,945,448 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076675

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	13	77,940,477 - 77,942,630 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076962

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	13	77,940,470 - 77,945,507 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107268 ⟹ ENSRNOP00000096001

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	72,429,086 - 72,434,915 (+)	Ensembl

RefSeq Acc Id:

NM_001105963 ⟹ NP_001099433

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	74,962,597 - 74,968,344 (+)	NCBI
mRatBN7.2	13	72,429,168 - 72,434,915 (+)	NCBI
Rnor_6.0	13	77,940,454 - 77,946,201 (+)	NCBI
Rnor_5.0	13	82,847,625 - 82,853,372 (+)	NCBI
RGSC_v3.4	13	75,614,841 - 75,620,588 (+)	RGD
Celera	13	72,234,949 - 72,240,696 (+)	RGD

Sequence:

show sequence

GGTTGGCTGGCTAGGCAGACAACATGGCGGCGTCCTTGCTGGGCTCGCTGCTGCGGACCTTCCGGCAGGCAGTTCCTCTGTCATCGTCAGGTCAAGCTCGAGGTTACTATGTAGACTGGAGAATGTTG
CGTGATGTGAAGAGACGAAAAATGGCTTATGAATATGCAGATGAGCGGCTTCGGATCAATTCGCTCAGAAAGAATACCATTTTGCCAAAAGACCTTCAGGAAATGGCTGGTGATGAAATTGCTGCCCT
TCCACGGGATAGCTGTCCTGTTAGAATCAGAAATCGGTGTGTCATGACATCTCGCCCCCGCGGTGTTAAGCGTCGCTGGAGACTTAGTCGCATTGTTTTCCGACACTTAGCTGACCATGGGCTACTTT
CTGGAGTCCAGCGAGCAATATGGTGACAGTTTCCAAACCTGCCCAGCTGCCAGGGAAGCCAGTCCTGGCAAAAGACTTAAGACTAAACCCTAGGGTTCATAGGGGTCTAGTATGTTTAGTCTACTTGA
CTCTGAGTGAAACTACCCTTTTGATTTAAATAAATAAAAGTGGTTATTTGTCATTGAATTGTCTTTTAACTTTAAAGCATATATTACTCCCATACATGGTGTAAGAGTGGAATTAAAAATATTTTCTG
TGAAAGTATGGTGTTTTCCTTCAAGTTTGATGTTTAGTAGCAAAATATATTTTTTAGAGTGATTTCACAAAATCCTTCTAGAAGGCAGATCTAATTGACAGGCTATGCTATATTCCTGAGCTAGCTTA
GTGTCCCTGGTCTGCAGTTACTATCACTTTTTGGATAACAATAGATGGAGAGTTAAACAGAATATTCTAAATATTTAGGGTCAACTTTATGTGACAGTGAATTAAAGAACTGCTAAATAGTTGTTTCA
TCCTTTAAAATTTCCCATTAATGCGTTATCAGTGTTTTATATGCATGTAAACCTGTGCTCCGTGTGGTCTGGGCCTGGTACTGAAGGCAAGAGGAAGGCACTGGATCCCAAGTTAGTTGTGAGGAACC
AACATTTAAAGCTTACCTGTTGCCTAGTGGCTTAGACATTTCAATGATTGTTGTGTGGCACGGATCTGTTTTTGTTAAGAATTGTAATGAGTTTATAATTCTATCTTTGCTGCATCTCTTGGGTTTTT
GTTGTCATTTTGTTTTTTAAGAACTTTCCCTATCAACAATTACTAAAATATATTTGGCGTAAATGTGTAATAAATGTTCAGAGTAAATGAGTTGCTATACTACCAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA

hide sequence

RefSeq Acc Id:

XM_006250098 ⟹ XP_006250160

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	74,962,605 - 74,968,344 (+)	NCBI
mRatBN7.2	13	72,429,271 - 72,434,793 (+)	NCBI
Rnor_6.0	13	77,940,528 - 77,945,588 (+)	NCBI
Rnor_5.0	13	82,847,625 - 82,853,372 (+)	NCBI

Sequence:

show sequence

CCTCTGCCTTTCTCGCCACCCCAACCTCTTCCCTGAATTCTGTATCCTATGTGTCCCTCGTAAC
CCTGACACCTGTAATGCGCACGGAGGACCAATCCCAAGGCTCCTTTCTGCTTTCCCGCTCCGGCTAAGTTAGGAGACCCCTAATGGCAATCGAAGGTTTGGTATTCAAGTGTGGATCCGAGGCAGTTC
CTCTGTCATCGTCAGGTCAAGCTCGAGGTTACTATGTAGACTGGAGAATGTTGCGTGATGTGAAGAGACGAAAAATGGCTTATGAATATGCAGATGAGCGGCTTCGGATCAATTCGCTCAGAAAGAAT
ACCATTTTGCCAAAAGACCTTCAGGAAATGGCTGGTGATGAAATTGCTGCCCTTCCACGGGATAGCTGTCCTGTTAGAATCAGAAATCGGTGTGTCATGACATCTCGCCCCCGCGGTGTTAAGCGTCG
CTGGAGACTTAGTCGCATTGTTTTCCGACACTTAGCTGACCATGGGCTACTTTCTGGAGTCCAGCGAGCAATATGGTGACAGTTTCCAAACCTGCCCAGCTGCCAGGGAAGCCAGTCCTGGCAAAAGA
CTTAAGACTAAACCCTAGGGTTCATAGGGGTCTAGTATGTTTAGTCTACTTGACTCTGAGTGAAACTACCCTTTTGATTTAAATAAATAAAAGTGGTTATTTGTCATTGAATTGTCTTTTAACTTTAA
AGCATATATTACTCCCATACATGGTGTAAGAGTGGAATTAAAAATATTTTCTGTGAAA

hide sequence


Protein RefSeqs	NP_001099433	(Get FASTA)	NCBI Sequence Viewer
	XP_006250160	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI66895	(Get FASTA)	NCBI Sequence Viewer
	EDM09440	(Get FASTA)	NCBI Sequence Viewer
	EDM09441	(Get FASTA)	NCBI Sequence Viewer
	EDM09442	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000003460.5
	ENSRNOP00000088664.1
	ENSRNOP00000096001.1
	ENSRNOP00000099935

RefSeq Acc Id:	NP_001099433 ⟸ NM_001105963
- UniProtKB:	B2RYT4 (UniProtKB/TrEMBL), A0A8I6AAC9 (UniProtKB/TrEMBL), F7F3Q8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAASLLGSLLRTFRQAVPLSSSGQARGYYVDWRMLRDVKRRKMAYEYADERLRINSLRKNTILPKDLQEMAGDEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGLLSGVQRAIW hide sequence

RefSeq Acc Id:	XP_006250160 ⟸ XM_006250098
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6AMX3 (UniProtKB/TrEMBL), F7F3Q8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAIEGLVFKCGSEAVPLSSSGQARGYYVDWRMLRDVKRRKMAYEYADERLRINSLRKNTILPKDLQEMAGDEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGLLSGVQRAIW hide sequence

Ensembl Acc Id:

ENSRNOP00000003460 ⟸ ENSRNOT00000003460

Ensembl Acc Id:

ENSRNOP00000096001 ⟸ ENSRNOT00000107268

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2RYT4-F1-model_v2	AlphaFold	B2RYT4	1-128	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13698925

Promoter ID:

EPDNEW_R9450

Type:

multiple initiation site

Name:

Mrps14_1

Description:

mitochondrial ribosomal protein S14

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	77,940,470 - 77,940,530	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-17764	BioCyc
Ensembl Genes	ENSRNOG00000002569	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00000079901	ENTREZGENE
Ensembl Transcript	ENSRNOT00000003460.7	UniProtKB/TrEMBL
	ENSRNOT00000076320.2	UniProtKB/TrEMBL
	ENSRNOT00000107268.1	UniProtKB/TrEMBL
	ENSRNOT00000164241	ENTREZGENE
Gene3D-CATH	1.10.287.1480	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6920474	IMAGE-MGC_LOAD
InterPro	Ribosomal_S14	UniProtKB/TrEMBL
KEGG Report	rno:289143	UniProtKB/TrEMBL
MGC_CLONE	MGC:188850	IMAGE-MGC_LOAD
NCBI Gene	289143	ENTREZGENE
PANTHER	28S RIBOSOMAL PROTEIN S14, MITOCHONDRIAL	UniProtKB/TrEMBL
	Ribosomal_S14	UniProtKB/TrEMBL
Pfam	Ribosomal_S14	UniProtKB/TrEMBL
PhenoGen	Mrps14	PhenoGen
RatGTEx	ENSRNOG00000002569	RatGTEx
	ENSRNOG00000079901	RatGTEx
Superfamily-SCOP	Glucocorticoid receptor-like (DNA-binding domain)	UniProtKB/TrEMBL
UniProt	A0A8I6AAC9	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AMX3	ENTREZGENE, UniProtKB/TrEMBL
	B2RYT4	ENTREZGENE, UniProtKB/TrEMBL
	F7F3Q8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Mrps14	mitochondrial ribosomal protein S14	Mrps14_predicted	mitochondrial ribosomal protein S14 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Mrps14_predicted	mitochondrial ribosomal protein S14 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM