Symbol:
Sec23ip
Name:
SEC23 interacting protein
RGD ID:
1309328
Description:
Predicted to enable phospholipase activity. Predicted to act upstream of or within acrosome assembly and single fertilization. Predicted to be located in cis-Golgi network; endoplasmic reticulum exit site; and perinuclear endoplasmic reticulum. Predicted to be active in COPII-coated ER to Golgi transport vesicle. Orthologous to human SEC23IP (SEC23 interacting protein); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC309010; MGC112877; SEC23-interacting protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 192,751,379 - 192,794,345 (+) NCBI GRCr8 mRatBN7.2 1 183,320,950 - 183,363,944 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 183,321,075 - 183,363,920 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 191,671,438 - 191,713,745 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 198,857,519 - 198,899,828 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 191,527,749 - 191,570,157 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 200,167,075 - 200,210,362 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 200,167,169 - 200,210,377 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 207,214,612 - 207,257,767 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 187,999,550 - 188,042,408 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 188,149,514 - 188,187,683 (+) NCBI Celera 1 180,967,104 - 181,009,305 (+) NCBI Celera Cytogenetic Map 1 q37 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sec23ip Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of SEC23IP mRNA] CTD PMID:31150632 Sec23ip Rat 17alpha-ethynylestradiol increases expression ISO Sec23ip (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of SEC23IP mRNA CTD PMID:17942748 Sec23ip Rat 17beta-estradiol increases expression ISO Sec23ip (Mus musculus) 6480464 Estradiol results in increased expression of SEC23IP mRNA CTD PMID:39298647 Sec23ip Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Sec23ip (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SEC23IP mRNA CTD PMID:21570461 Sec23ip Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SEC23IP mRNA CTD PMID:33387578 Sec23ip Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of SEC23IP mRNA CTD PMID:21346803 Sec23ip Rat 2,6-dimethoxyphenol multiple interactions ISO SEC23IP (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of SEC23IP protein CTD PMID:38598786 Sec23ip Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of SEC23IP mRNA CTD PMID:21346803 Sec23ip Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Sec23ip (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of SEC23IP mRNA CTD PMID:26251327 Sec23ip Rat 4,4'-sulfonyldiphenol increases expression ISO Sec23ip (Mus musculus) 6480464 bisphenol S results in increased expression of SEC23IP mRNA CTD PMID:39298647 Sec23ip Rat 4,4'-sulfonyldiphenol increases expression ISO SEC23IP (Homo sapiens) 6480464 bisphenol S results in increased expression of SEC23IP protein CTD PMID:34186270 Sec23ip Rat Aroclor 1254 decreases expression ISO Sec23ip (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of SEC23IP mRNA CTD PMID:23650126 Sec23ip Rat arsane multiple interactions ISO SEC23IP (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SEC23IP mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SEC23IP mRNA CTD PMID:39836092 Sec23ip Rat arsenic atom multiple interactions ISO SEC23IP (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SEC23IP mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SEC23IP mRNA CTD PMID:39836092 Sec23ip Rat benzo[a]pyrene increases expression ISO Sec23ip (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SEC23IP mRNA CTD PMID:22228805 Sec23ip Rat benzo[a]pyrene diol epoxide I decreases expression ISO SEC23IP (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Sec23ip Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SEC23IP mRNA CTD PMID:25181051 Sec23ip Rat bisphenol A increases expression ISO SEC23IP (Homo sapiens) 6480464 bisphenol A results in increased expression of SEC23IP protein CTD PMID:34186270 and PMID:37567409 Sec23ip Rat bisphenol AF increases expression ISO SEC23IP (Homo sapiens) 6480464 bisphenol AF results in increased expression of SEC23IP protein CTD PMID:34186270 Sec23ip Rat cadmium dichloride decreases expression ISO SEC23IP (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of SEC23IP mRNA CTD PMID:38568856 Sec23ip Rat caffeine decreases phosphorylation ISO SEC23IP (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of SEC23IP protein CTD PMID:35688186 Sec23ip Rat chlorpyrifos decreases expression ISO Sec23ip (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of SEC23IP mRNA CTD PMID:37019170 Sec23ip Rat clofibrate decreases expression ISO Sec23ip (Mus musculus) 6480464 Clofibrate results in decreased expression of SEC23IP mRNA CTD PMID:23811191 Sec23ip Rat copper(II) sulfate decreases expression ISO SEC23IP (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of SEC23IP mRNA CTD PMID:19549813 Sec23ip Rat cyclosporin A increases expression ISO SEC23IP (Homo sapiens) 6480464 Cyclosporine results in increased expression of SEC23IP mRNA CTD PMID:20106945 Sec23ip Rat DDE increases expression ISO SEC23IP (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of SEC23IP mRNA CTD PMID:38568856 Sec23ip Rat doxorubicin decreases expression ISO SEC23IP (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SEC23IP mRNA CTD PMID:29803840 Sec23ip Rat enzyme inhibitor multiple interactions ISO SEC23IP (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of SEC23IP protein CTD PMID:23301498 Sec23ip Rat epoxiconazole increases expression ISO Sec23ip (Mus musculus) 6480464 epoxiconazole results in increased expression of SEC23IP mRNA CTD PMID:35436446 Sec23ip Rat ethyl methanesulfonate decreases expression ISO SEC23IP (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of SEC23IP mRNA CTD PMID:23649840 Sec23ip Rat folic acid decreases expression ISO Sec23ip (Mus musculus) 6480464 Folic Acid results in decreased expression of SEC23IP mRNA CTD PMID:25629700 Sec23ip Rat formaldehyde decreases expression ISO SEC23IP (Homo sapiens) 6480464 Formaldehyde results in decreased expression of SEC23IP mRNA CTD PMID:23649840 Sec23ip Rat FR900359 decreases phosphorylation ISO SEC23IP (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of SEC23IP protein CTD PMID:37730182 Sec23ip Rat furfural multiple interactions ISO SEC23IP (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of SEC23IP protein CTD PMID:38598786 Sec23ip Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of SEC23IP mRNA CTD PMID:24136188 Sec23ip Rat hydrogen peroxide affects expression ISO SEC23IP (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of SEC23IP mRNA CTD PMID:20044591 Sec23ip Rat ivermectin decreases expression ISO SEC23IP (Homo sapiens) 6480464 Ivermectin results in decreased expression of SEC23IP protein CTD PMID:32959892 Sec23ip Rat manganese atom multiple interactions ISO SEC23IP (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SEC23IP mRNA CTD PMID:39836092 Sec23ip Rat manganese(0) multiple interactions ISO SEC23IP (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SEC23IP mRNA CTD PMID:39836092 Sec23ip Rat manganese(II) chloride multiple interactions ISO SEC23IP (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SEC23IP mRNA CTD PMID:39836092 Sec23ip Rat methylparaben increases expression ISO SEC23IP (Homo sapiens) 6480464 methylparaben results in increased expression of SEC23IP mRNA CTD PMID:31745603 Sec23ip Rat mifepristone increases expression ISO SEC23IP (Homo sapiens) 6480464 Mifepristone results in increased expression of SEC23IP mRNA CTD PMID:17584828 Sec23ip Rat nickel atom decreases expression ISO SEC23IP (Homo sapiens) 6480464 Nickel results in decreased expression of SEC23IP mRNA CTD PMID:23195993 Sec23ip Rat paracetamol affects expression ISO Sec23ip (Mus musculus) 6480464 Acetaminophen affects the expression of SEC23IP mRNA CTD PMID:17562736 Sec23ip Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of SEC23IP mRNA CTD PMID:33387578 Sec23ip Rat paracetamol decreases expression ISO SEC23IP (Homo sapiens) 6480464 Acetaminophen results in decreased expression of SEC23IP mRNA CTD PMID:21420995 Sec23ip Rat perfluorooctanoic acid decreases expression ISO SEC23IP (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of SEC23IP protein CTD PMID:26879310 Sec23ip Rat resveratrol multiple interactions ISO SEC23IP (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of SEC23IP mRNA CTD PMID:23557933 Sec23ip Rat silicon dioxide increases expression ISO SEC23IP (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of SEC23IP mRNA CTD PMID:25351596 Sec23ip Rat silver atom decreases expression ISO Sec23ip (Mus musculus) 6480464 Silver results in decreased expression of SEC23IP mRNA CTD PMID:27131904 Sec23ip Rat silver(0) decreases expression ISO Sec23ip (Mus musculus) 6480464 Silver results in decreased expression of SEC23IP mRNA CTD PMID:27131904 Sec23ip Rat sodium arsenite increases expression ISO SEC23IP (Homo sapiens) 6480464 sodium arsenite results in increased expression of SEC23IP mRNA CTD PMID:38568856 Sec23ip Rat sodium arsenite multiple interactions ISO SEC23IP (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SEC23IP mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SEC23IP mRNA CTD PMID:39836092 Sec23ip Rat sodium chloride multiple interactions ISO SEC23IP (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of SEC23IP protein more ... CTD PMID:38598786 Sec23ip Rat testosterone enanthate affects expression ISO SEC23IP (Homo sapiens) 6480464 testosterone enanthate affects the expression of SEC23IP mRNA CTD PMID:17440010 Sec23ip Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of SEC23IP mRNA] CTD PMID:31150632 Sec23ip Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of SEC23IP mRNA CTD PMID:31150632 Sec23ip Rat thapsigargin increases expression ISO Sec23ip (Mus musculus) 6480464 Thapsigargin results in increased expression of SEC23IP protein CTD PMID:24648495 Sec23ip Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of SEC23IP mRNA CTD PMID:23411599 Sec23ip Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of SEC23IP mRNA CTD PMID:33387578 Sec23ip Rat trimellitic anhydride increases expression ISO Sec23ip (Mus musculus) 6480464 trimellitic anhydride results in increased expression of SEC23IP mRNA CTD PMID:19042947 Sec23ip Rat triphenyl phosphate affects expression ISO SEC23IP (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SEC23IP mRNA CTD PMID:37042841 Sec23ip Rat valproic acid affects expression ISO SEC23IP (Homo sapiens) 6480464 Valproic Acid affects the expression of SEC23IP mRNA CTD PMID:25979313 Sec23ip Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of SEC23IP mRNA CTD PMID:23034163
(+)-schisandrin B (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) cadmium dichloride (ISO) caffeine (ISO) chlorpyrifos (ISO) clofibrate (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) DDE (ISO) doxorubicin (ISO) enzyme inhibitor (ISO) epoxiconazole (ISO) ethyl methanesulfonate (ISO) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) furfural (ISO) glafenine (EXP) hydrogen peroxide (ISO) ivermectin (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methylparaben (ISO) mifepristone (ISO) nickel atom (ISO) paracetamol (EXP,ISO) perfluorooctanoic acid (ISO) resveratrol (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium chloride (ISO) testosterone enanthate (ISO) tetrachloromethane (EXP) thapsigargin (ISO) thioacetamide (EXP) trichloroethene (EXP) trimellitic anhydride (ISO) triphenyl phosphate (ISO) valproic acid (ISO) vinclozolin (EXP)
Sec23ip Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 192,751,379 - 192,794,345 (+) NCBI GRCr8 mRatBN7.2 1 183,320,950 - 183,363,944 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 183,321,075 - 183,363,920 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 191,671,438 - 191,713,745 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 198,857,519 - 198,899,828 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 191,527,749 - 191,570,157 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 200,167,075 - 200,210,362 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 200,167,169 - 200,210,377 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 207,214,612 - 207,257,767 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 187,999,550 - 188,042,408 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 188,149,514 - 188,187,683 (+) NCBI Celera 1 180,967,104 - 181,009,305 (+) NCBI Celera Cytogenetic Map 1 q37 NCBI
SEC23IP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 119,892,730 - 119,944,657 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 119,892,707 - 119,944,657 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 121,652,242 - 121,704,169 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 121,642,213 - 121,691,235 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 121,642,212 - 121,691,235 NCBI Celera 10 115,383,262 - 115,432,278 (+) NCBI Celera Cytogenetic Map 10 q26.11-q26.12 NCBI HuRef 10 115,281,153 - 115,333,167 (+) NCBI HuRef CHM1_1 10 121,936,950 - 121,989,022 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 120,790,271 - 120,842,184 (+) NCBI T2T-CHM13v2.0
Sec23ip Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 128,346,667 - 128,386,560 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 128,346,667 - 128,386,560 (+) Ensembl GRCm39 Ensembl GRCm38 7 128,744,862 - 128,784,836 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 128,744,943 - 128,784,836 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 135,888,384 - 135,928,350 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 128,536,129 - 128,574,935 (+) NCBI MGSCv36 mm8 Celera 7 128,584,210 - 128,623,989 (+) NCBI Celera Cytogenetic Map 7 F3 NCBI cM Map 7 70.51 NCBI
Sec23ip Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955551 695,026 - 746,669 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955551 695,026 - 746,359 (+) NCBI ChiLan1.0 ChiLan1.0
SEC23IP Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 131,746,972 - 131,798,988 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 131,752,326 - 131,804,344 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 116,460,187 - 116,510,830 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 119,876,573 - 119,927,321 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 119,876,408 - 119,928,064 (+) Ensembl panpan1.1 panPan2
SEC23IP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 30,007,780 - 30,047,513 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 30,007,774 - 30,046,785 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 30,149,350 - 30,189,081 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 30,539,211 - 30,579,379 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 30,539,245 - 30,579,379 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 30,091,651 - 30,131,366 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 30,114,471 - 30,154,231 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 30,307,058 - 30,346,795 (+) NCBI UU_Cfam_GSD_1.0
Sec23ip Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 16,286,129 - 16,329,708 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936486 9,231,351 - 9,275,778 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936486 9,231,610 - 9,275,555 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SEC23IP Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 129,758,288 - 129,810,642 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 129,758,279 - 129,810,642 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 141,285,475 - 141,346,818 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SEC23IP Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 112,685,033 - 112,734,520 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 112,684,885 - 112,735,082 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 73,960,612 - 74,010,649 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sec23ip
.
Predicted Target Of
Count of predictions: 198 Count of miRNA genes: 148 Interacting mature miRNAs: 168 Transcripts: ENSRNOT00000027665 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 70160 Bw18 Body weight QTL 18 5.7 body mass (VT:0001259) body weight (CMO:0000012) 1 144267353 196383668 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 61343 Bp28 Blood pressure QTL 28 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 151646613 196646613 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 61378 Bp43 Blood pressure QTL 43 22.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 181746937 196383668 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 2312558 Glom17 Glomerulus QTL 17 3.9 0.001 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 166532971 191278129 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 619614 Bp78 Blood pressure QTL 78 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 169112897 197261052 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat 2325725 Eae31 Experimental allergic encephalomyelitis QTL 31 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 1 178810256 188377506 Rat 631670 Iddm10 Insulin dependent diabetes mellitus QTL 10 1.9 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 174133260 196383668 Rat
BE098390
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 183,326,747 - 183,326,942 (+) MAPPER mRatBN7.2 Rnor_6.0 1 200,172,873 - 200,173,067 NCBI Rnor6.0 Rnor_5.0 1 207,220,410 - 207,220,604 UniSTS Rnor5.0 RGSC_v3.4 1 188,005,318 - 188,005,512 UniSTS RGSC3.4 Celera 1 180,972,890 - 180,973,084 UniSTS RH 3.4 Map 1 1418.09 UniSTS Cytogenetic Map 1 q37 UniSTS
BI286725
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 183,363,506 - 183,363,684 (+) MAPPER mRatBN7.2 Rnor_6.0 1 200,209,925 - 200,210,102 NCBI Rnor6.0 Rnor_5.0 1 207,257,330 - 207,257,507 UniSTS Rnor5.0 RGSC_v3.4 1 188,042,626 - 188,042,803 UniSTS RGSC3.4 Celera 1 181,009,523 - 181,009,700 UniSTS RH 3.4 Map 1 1417.59 UniSTS Cytogenetic Map 1 q37 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000027665 ⟹ ENSRNOP00000027665
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 183,321,075 - 183,363,920 (+) Ensembl Rnor_6.0 Ensembl 1 200,167,169 - 200,210,377 (+) Ensembl
RefSeq Acc Id:
NM_001134859 ⟹ NP_001128331
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 192,751,381 - 192,793,690 (+) NCBI mRatBN7.2 1 183,320,975 - 183,363,289 (+) NCBI Rnor_6.0 1 200,167,106 - 200,209,707 (+) NCBI Rnor_5.0 1 207,214,612 - 207,257,767 (+) NCBI RGSC_v3.4 1 187,999,550 - 188,042,408 (+) RGD Celera 1 180,967,104 - 181,009,305 (+) RGD
Sequence:
GTCAGCTTCCGGAAGAAAATCGGTCCCTTAGTCGCTGTCCTGTGGTCACCGTGCGCAGGTGCGGAAGTGCGGTGGCATGCTCAGGACCGGTTTCCGGTCTGTGTGAGGCACCGGGCTCGCAGAGCCAC
hide sequence
RefSeq Acc Id:
XM_006230387 ⟹ XP_006230449
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 192,751,379 - 192,794,345 (+) NCBI mRatBN7.2 1 183,321,021 - 183,363,944 (+) NCBI Rnor_6.0 1 200,167,153 - 200,210,362 (+) NCBI Rnor_5.0 1 207,214,612 - 207,257,767 (+) NCBI
Sequence:
ACCGTGCGCAGGTGCGGAAGTGCGGTGGCATGCTCAGGACCGGTTTCCGGTCTGTGTGAGGCACCGGGCTCGCAGAGCCACGTAACGGACGGGGGTCTGCAACCATGGCGGATAGGAAGGCTAACGGT
hide sequence
RefSeq Acc Id:
NP_001128331 ⟸ NM_001134859
- UniProtKB:
G3V8Q8 (UniProtKB/TrEMBL), A6IA19 (UniProtKB/TrEMBL), A6IA18 (UniProtKB/TrEMBL)
- Sequence:
MADRKANGGGASASSSGTNLLFSSSATEFSFNVPFIPVTQAAASPASLLLPGEDSTDVGEEDSFLGQTSTHTSTPQTFSYFSQVSSSSDPFGNIGQSPLATTAMSAGQSALPKPPATLPFTTGSQDML
hide sequence
RefSeq Acc Id:
XP_006230449 ⟸ XM_006230387
- Peptide Label:
isoform X1
- UniProtKB:
A6IA18 (UniProtKB/TrEMBL)
- Sequence:
MADRKANGGGASASSSGTNLLFSSSATEFSFNVPFIPVTQAAASPASLLLPGEDSTDVGEEDSFLGQTSTHTSTPQTFSYFSQVSSSSDPFGNIGQSPLATTAMSAGQSALPKPPATLPFTTGSQDML
hide sequence
Ensembl Acc Id:
ENSRNOP00000027665 ⟸ ENSRNOT00000027665
RGD ID: 13690465 Promoter ID: EPDNEW_R989 Type: initiation region Name: Sec23ip_1 Description: SEC23 interacting protein SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 200,167,206 - 200,167,266 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-12-06
Sec23ip
SEC23 interacting protein
Sec23ip_predicted
SEC23 interacting protein (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Sec23ip_predicted
SEC23 interacting protein (predicted)
Symbol and Name status set to approved
70820 APPROVED
