Symbol:
Ppp4r2
Name:
protein phosphatase 4, regulatory subunit 2
RGD ID:
1307312
Description:
Predicted to enable protein phosphatase regulator activity and protein-macromolecule adaptor activity. Predicted to be involved in regulation of double-strand break repair via homologous recombination. Predicted to act upstream of or within hematopoietic progenitor cell differentiation. Predicted to be located in chromatin and nucleoplasm. Predicted to be part of protein phosphatase 4 complex. Predicted to be active in cytoplasm and nucleus. Orthologous to human PPP4R2 (protein phosphatase 4 regulatory subunit 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amitrole.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC297486; serine/threonine-protein phosphatase 4 regulatory subunit 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PPP4R2 (protein phosphatase 4 regulatory subunit 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Ppp4r2 (protein phosphatase 4, regulatory subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ppp4r2 (protein phosphatase 4 regulatory subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PPP4R2 (protein phosphatase 4 regulatory subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PPP4R2 (protein phosphatase 4 regulatory subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ppp4r2 (protein phosphatase 4 regulatory subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PPP4R2 (protein phosphatase 4 regulatory subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LOC103227906 (serine/threonine-protein phosphatase 4 regulatory subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ppp4r2 (protein phosphatase 4 regulatory subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CFDP1 (craniofacial development protein 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
PPP4R2 (protein phosphatase 4 regulatory subunit 2)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ppp4r2 (protein phosphatase 4, regulatory subunit 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ppp4r2b (protein phosphatase 4, regulatory subunit 2b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
ppp4r2a (protein phosphatase 4, regulatory subunit 2a)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PSY4
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
PPP4R2r
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ppfr-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
ppp4r2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 135,010,919 - 135,051,844 (+) NCBI GRCr8 mRatBN7.2 4 133,454,555 - 133,495,486 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 133,454,555 - 133,495,486 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 138,863,278 - 138,904,185 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 134,644,046 - 134,684,959 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 133,264,682 - 133,305,586 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 133,285,552 - 133,323,755 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 133,285,552 - 133,323,755 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 197,767,067 - 197,805,270 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 135,720,581 - 135,761,507 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 135,965,391 - 136,006,348 (+) NCBI Celera 4 122,298,049 - 122,338,902 (+) NCBI Celera Cytogenetic Map 4 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ppp4r2 Rat 1,2-dimethylhydrazine affects expression ISO Ppp4r2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of PPP4R2 mRNA CTD PMID:22206623 Ppp4r2 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO PPP4R2 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Ppp4r2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PPP4R2 mRNA CTD PMID:34747641 Ppp4r2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PPP4R2 mRNA CTD PMID:33387578 Ppp4r2 Rat 2,4,6-tribromophenol decreases expression ISO PPP4R2 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Ppp4r2 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO PPP4R2 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of PPP4R2 protein CTD PMID:31675489 Ppp4r2 Rat 3-methylcholanthrene multiple interactions ISO Ppp4r2 (Mus musculus) 6480464 [Methylcholanthrene co-treated with Nanotubes and Carbon] results in decreased expression of PPP4R2 mRNA CTD PMID:25926378 Ppp4r2 Rat 4,4'-sulfonyldiphenol increases expression ISO Ppp4r2 (Mus musculus) 6480464 bisphenol S results in increased expression of PPP4R2 mRNA CTD PMID:39298647 Ppp4r2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PPP4R2 mRNA CTD PMID:30047161 Ppp4r2 Rat aflatoxin B1 decreases methylation ISO PPP4R2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PPP4R2 gene CTD PMID:27153756 Ppp4r2 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of PPP4R2 mRNA CTD PMID:30047161 Ppp4r2 Rat antirheumatic drug increases expression ISO PPP4R2 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of PPP4R2 mRNA CTD PMID:24449571 Ppp4r2 Rat aristolochic acid A decreases expression ISO PPP4R2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PPP4R2 mRNA CTD PMID:33212167 Ppp4r2 Rat Aroclor 1254 decreases expression ISO Ppp4r2 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of PPP4R2 mRNA CTD PMID:23650126 Ppp4r2 Rat arsenite(3-) multiple interactions ISO PPP4R2 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to PPP4R2 mRNA] CTD PMID:32406909 Ppp4r2 Rat azathioprine increases expression ISO PPP4R2 (Homo sapiens) 6480464 Azathioprine results in increased expression of PPP4R2 mRNA CTD PMID:19192274 Ppp4r2 Rat benzo[a]pyrene decreases expression ISO PPP4R2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PPP4R2 mRNA CTD PMID:21632981 Ppp4r2 Rat benzo[a]pyrene diol epoxide I decreases expression ISO PPP4R2 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Ppp4r2 Rat benzo[e]pyrene decreases methylation ISO PPP4R2 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of PPP4R2 intron CTD PMID:30157460 Ppp4r2 Rat beta-lapachone decreases expression ISO PPP4R2 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of PPP4R2 mRNA CTD PMID:38218311 Ppp4r2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Ppp4r2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of PPP4R2 mRNA CTD PMID:33754040 Ppp4r2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PPP4R2 mRNA CTD PMID:25181051 and PMID:30816183 Ppp4r2 Rat bisphenol A affects expression ISO PPP4R2 (Homo sapiens) 6480464 bisphenol A affects the expression of PPP4R2 mRNA CTD PMID:30903817 Ppp4r2 Rat cadmium atom multiple interactions ISO PPP4R2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PPP4R2 mRNA CTD PMID:35301059 Ppp4r2 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of PPP4R2 mRNA CTD PMID:21297351 Ppp4r2 Rat cadmium dichloride multiple interactions ISO PPP4R2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PPP4R2 mRNA CTD PMID:35301059 Ppp4r2 Rat caffeine affects phosphorylation ISO PPP4R2 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of PPP4R2 protein CTD PMID:35688186 Ppp4r2 Rat carbon nanotube multiple interactions ISO Ppp4r2 (Mus musculus) 6480464 [Methylcholanthrene co-treated with Nanotubes and Carbon] results in decreased expression of PPP4R2 mRNA CTD PMID:25926378 Ppp4r2 Rat cidofovir anhydrous decreases expression ISO PPP4R2 (Homo sapiens) 6480464 Cidofovir results in decreased expression of PPP4R2 mRNA CTD PMID:25596134 Ppp4r2 Rat cisplatin decreases expression ISO PPP4R2 (Homo sapiens) 6480464 Cisplatin results in decreased expression of PPP4R2 mRNA CTD PMID:25596134 Ppp4r2 Rat clodronic acid decreases expression ISO PPP4R2 (Homo sapiens) 6480464 Clodronic Acid results in decreased expression of PPP4R2 mRNA CTD PMID:25596134 Ppp4r2 Rat clozapine multiple interactions ISO PPP4R2 (Homo sapiens) 6480464 [Cuprizone co-treated with Clozapine] results in increased expression of PPP4R2 protein CTD PMID:34122009 Ppp4r2 Rat copper(II) sulfate decreases expression ISO PPP4R2 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of PPP4R2 mRNA CTD PMID:19549813 Ppp4r2 Rat coumarin affects phosphorylation ISO PPP4R2 (Homo sapiens) 6480464 coumarin affects the phosphorylation of PPP4R2 protein CTD PMID:35688186 Ppp4r2 Rat Cuprizon decreases expression ISO PPP4R2 (Homo sapiens) 6480464 Cuprizone results in decreased expression of PPP4R2 protein CTD PMID:34122009 Ppp4r2 Rat Cuprizon multiple interactions ISO PPP4R2 (Homo sapiens) 6480464 [Cuprizone co-treated with Clozapine] results in increased expression of PPP4R2 protein CTD PMID:34122009 Ppp4r2 Rat cyclosporin A decreases expression ISO Ppp4r2 (Mus musculus) 6480464 Cyclosporine results in decreased expression of PPP4R2 mRNA CTD PMID:19770486 Ppp4r2 Rat decabromodiphenyl ether increases expression ISO PPP4R2 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of PPP4R2 protein CTD PMID:31675489 Ppp4r2 Rat diazinon increases methylation ISO PPP4R2 (Homo sapiens) 6480464 Diazinon results in increased methylation of PPP4R2 gene CTD PMID:22964155 Ppp4r2 Rat dicrotophos decreases expression ISO PPP4R2 (Homo sapiens) 6480464 dicrotophos results in decreased expression of PPP4R2 mRNA CTD PMID:28302478 Ppp4r2 Rat dioxygen affects expression ISO PPP4R2 (Homo sapiens) 6480464 Oxygen deficiency affects the expression of PPP4R2 mRNA CTD PMID:25596134 Ppp4r2 Rat dorsomorphin multiple interactions ISO PPP4R2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ppp4r2 Rat doxorubicin decreases expression ISO PPP4R2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PPP4R2 mRNA CTD PMID:29803840 Ppp4r2 Rat enzyme inhibitor multiple interactions ISO PPP4R2 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of PPP4R2 protein CTD PMID:23301498 Ppp4r2 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PPP4R2 mRNA CTD PMID:24136188 Ppp4r2 Rat formaldehyde decreases expression ISO PPP4R2 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of PPP4R2 mRNA CTD PMID:20655997 and PMID:23649840 Ppp4r2 Rat FR900359 affects phosphorylation ISO PPP4R2 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of PPP4R2 protein CTD PMID:37730182 Ppp4r2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PPP4R2 mRNA CTD PMID:22061828 and PMID:33387578 Ppp4r2 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of PPP4R2 mRNA CTD PMID:24136188 Ppp4r2 Rat hydrogen peroxide multiple interactions ISO Ppp4r2 (Mus musculus) 6480464 N-(oxo-5 more ... CTD PMID:31494107 Ppp4r2 Rat hydrogen peroxide increases phosphorylation ISO Ppp4r2 (Mus musculus) 6480464 Hydrogen Peroxide results in increased phosphorylation of PPP4R2 protein CTD PMID:31494107 Ppp4r2 Rat indometacin decreases expression ISO PPP4R2 (Homo sapiens) 6480464 Indomethacin results in decreased expression of PPP4R2 mRNA CTD PMID:16984733 Ppp4r2 Rat ivermectin decreases expression ISO PPP4R2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PPP4R2 protein CTD PMID:32959892 Ppp4r2 Rat leflunomide increases expression ISO PPP4R2 (Homo sapiens) 6480464 leflunomide results in increased expression of PPP4R2 mRNA CTD PMID:28988120 Ppp4r2 Rat leflunomide decreases expression ISO Ppp4r2 (Mus musculus) 6480464 leflunomide results in decreased expression of PPP4R2 mRNA CTD PMID:19751817 Ppp4r2 Rat metformin decreases expression EXP 6480464 Metformin results in decreased expression of PPP4R2 mRNA CTD PMID:25596134 Ppp4r2 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of PPP4R2 mRNA CTD PMID:30467583 Ppp4r2 Rat methapyrilene decreases methylation ISO PPP4R2 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of PPP4R2 intron CTD PMID:30157460 Ppp4r2 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of PPP4R2 mRNA CTD PMID:30047161 Ppp4r2 Rat methotrexate increases expression ISO PPP4R2 (Homo sapiens) 6480464 Methotrexate results in increased expression of PPP4R2 mRNA CTD PMID:19192274 Ppp4r2 Rat methylmercury chloride decreases expression ISO PPP4R2 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PPP4R2 mRNA CTD PMID:28001369 Ppp4r2 Rat paracetamol decreases expression ISO PPP4R2 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PPP4R2 mRNA CTD PMID:21420995 Ppp4r2 Rat phenobarbital affects expression ISO PPP4R2 (Homo sapiens) 6480464 Phenobarbital affects the expression of PPP4R2 mRNA CTD PMID:19159669 Ppp4r2 Rat phenobarbital affects expression ISO Ppp4r2 (Mus musculus) 6480464 Phenobarbital affects the expression of PPP4R2 mRNA CTD PMID:23091169 Ppp4r2 Rat phenylmercury acetate decreases expression ISO PPP4R2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of PPP4R2 mRNA CTD PMID:26272509 Ppp4r2 Rat phenylmercury acetate multiple interactions ISO PPP4R2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PPP4R2 mRNA CTD PMID:27188386 Ppp4r2 Rat piroxicam increases expression ISO PPP4R2 (Homo sapiens) 6480464 Piroxicam results in increased expression of PPP4R2 mRNA CTD PMID:19192274 Ppp4r2 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of PPP4R2 mRNA CTD PMID:30047161 Ppp4r2 Rat resveratrol multiple interactions ISO PPP4R2 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of PPP4R2 mRNA CTD PMID:23557933 Ppp4r2 Rat SB 431542 multiple interactions ISO PPP4R2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ppp4r2 Rat silver atom decreases expression ISO Ppp4r2 (Mus musculus) 6480464 Silver results in decreased expression of PPP4R2 mRNA CTD PMID:27131904 Ppp4r2 Rat silver(0) decreases expression ISO Ppp4r2 (Mus musculus) 6480464 Silver results in decreased expression of PPP4R2 mRNA CTD PMID:27131904 Ppp4r2 Rat sodium aurothiomalate increases expression ISO PPP4R2 (Homo sapiens) 6480464 Gold Sodium Thiomalate results in increased expression of PPP4R2 mRNA CTD PMID:19192274 Ppp4r2 Rat sunitinib increases expression ISO PPP4R2 (Homo sapiens) 6480464 Sunitinib results in increased expression of PPP4R2 mRNA CTD PMID:31533062 Ppp4r2 Rat tetrachloromethane decreases expression ISO Ppp4r2 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of PPP4R2 mRNA CTD PMID:31919559 Ppp4r2 Rat triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of PPP4R2 mRNA CTD PMID:30589522 Ppp4r2 Rat triphenyl phosphate affects expression ISO PPP4R2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PPP4R2 mRNA CTD PMID:37042841 Ppp4r2 Rat triptonide increases expression ISO Ppp4r2 (Mus musculus) 6480464 triptonide results in increased expression of PPP4R2 mRNA CTD PMID:33045310 Ppp4r2 Rat valproic acid decreases methylation ISO PPP4R2 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of PPP4R2 gene CTD PMID:29154799 Ppp4r2 Rat valproic acid multiple interactions ISO PPP4R2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PPP4R2 mRNA CTD PMID:27188386 Ppp4r2 Rat valproic acid decreases expression ISO PPP4R2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PPP4R2 mRNA CTD PMID:23179753 more ...
1,2-dimethylhydrazine (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4,6-tribromophenol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) amitrole (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsenite(3-) (ISO) azathioprine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) carbon nanotube (ISO) cidofovir anhydrous (ISO) cisplatin (ISO) clodronic acid (ISO) clozapine (ISO) copper(II) sulfate (ISO) coumarin (ISO) Cuprizon (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) diazinon (ISO) dicrotophos (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) enzyme inhibitor (ISO) flutamide (EXP) formaldehyde (ISO) FR900359 (ISO) gentamycin (EXP) glafenine (EXP) hydrogen peroxide (ISO) indometacin (ISO) ivermectin (ISO) leflunomide (ISO) metformin (EXP) methapyrilene (EXP,ISO) methimazole (EXP) methotrexate (ISO) methylmercury chloride (ISO) paracetamol (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) piroxicam (ISO) pregnenolone 16alpha-carbonitrile (EXP) resveratrol (ISO) SB 431542 (ISO) silver atom (ISO) silver(0) (ISO) sodium aurothiomalate (ISO) sunitinib (ISO) tetrachloromethane (ISO) triphenyl phosphate (EXP,ISO) triptonide (ISO) valproic acid (ISO)
Ppp4r2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 135,010,919 - 135,051,844 (+) NCBI GRCr8 mRatBN7.2 4 133,454,555 - 133,495,486 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 133,454,555 - 133,495,486 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 138,863,278 - 138,904,185 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 134,644,046 - 134,684,959 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 133,264,682 - 133,305,586 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 133,285,552 - 133,323,755 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 133,285,552 - 133,323,755 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 197,767,067 - 197,805,270 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 135,720,581 - 135,761,507 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 135,965,391 - 136,006,348 (+) NCBI Celera 4 122,298,049 - 122,338,902 (+) NCBI Celera Cytogenetic Map 4 q34 NCBI
PPP4R2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 72,996,743 - 73,069,198 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 72,996,803 - 73,069,198 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 73,045,894 - 73,118,349 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 73,128,809 - 73,197,701 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 73,128,808 - 73,197,701 NCBI Celera 3 72,980,269 - 73,049,174 (+) NCBI Celera Cytogenetic Map 3 p13 NCBI HuRef 3 73,049,486 - 73,118,531 (+) NCBI HuRef CHM1_1 3 72,998,988 - 73,068,366 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 73,038,643 - 73,110,702 (+) NCBI T2T-CHM13v2.0
Ppp4r2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 100,810,596 - 100,846,891 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 100,810,583 - 100,846,895 (+) Ensembl GRCm39 Ensembl GRCm38 6 100,833,620 - 100,869,934 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 100,833,622 - 100,869,934 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 100,783,632 - 100,818,711 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 100,799,736 - 100,834,815 (+) NCBI MGSCv36 mm8 Celera 6 102,699,131 - 102,733,808 (+) NCBI Celera Cytogenetic Map 6 D3 NCBI cM Map 6 46.93 NCBI
Ppp4r2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955421 15,165,363 - 15,220,273 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955421 15,165,836 - 15,220,509 (-) NCBI ChiLan1.0 ChiLan1.0
PPP4R2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 72,954,832 - 73,027,137 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 72,959,619 - 73,031,924 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 72,939,529 - 73,012,073 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 74,863,935 - 74,935,446 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 74,835,788 - 74,935,446 (+) Ensembl panpan1.1 panPan2
PPP4R2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 19,116,122 - 19,166,927 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 19,118,124 - 19,167,264 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 19,093,392 - 19,145,730 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 19,149,605 - 19,201,740 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 19,151,362 - 19,201,742 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 18,837,061 - 18,889,180 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 19,178,646 - 19,230,657 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 19,250,023 - 19,302,369 (-) NCBI UU_Cfam_GSD_1.0
Ppp4r2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404942 3,994,554 - 4,040,642 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936603 3,987,275 - 4,041,991 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936603 3,994,594 - 4,041,972 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PPP4R2
LOC103227906 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 33,937,048 - 34,009,354 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 33,937,050 - 34,009,362 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666539 35,107 - 45,300 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ppp4r2
.
Predicted Target Of
Count of predictions: 323 Count of miRNA genes: 201 Interacting mature miRNAs: 238 Transcripts: ENSRNOT00000029115 Prediction methods: Miranda Result types: miRGate_prediction
1582232 Gluco25 Glucose level QTL 25 3.6 0.0023 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 85253748 148090731 Rat 631689 Scl4 Serum cholesterol level QTL 4 1.9 0.008 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 95174120 140174120 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1578655 Bmd11 Bone mineral density QTL 11 11 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 4 90850165 135850165 Rat 1300116 Hrtrt5 Heart rate QTL 5 3.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 116179486 151161268 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 631683 Bp116 Blood pressure QTL 116 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 124303370 169303370 Rat 61451 Ciaa4 CIA Autoantibody QTL 4 3.1 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 4 126395976 167139601 Rat 1549827 Scl46 Serum cholesterol level QTL 46 3.5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 132396220 177396220 Rat 731165 Uae21 Urinary albumin excretion QTL 21 2.4 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 106649412 151649412 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 7411558 Bw133 Body weight QTL 133 13.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 125590636 170590636 Rat 1549832 Bss3 Bone structure and strength QTL 3 11 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 4 109827074 154827074 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 737978 Pia23 Pristane induced arthritis QTL 23 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 70201 Gcr1 Gastric cancer resistance QTL 1 2.7 stomach morphology trait (VT:0000470) stomach tumor susceptibility score (CMO:0002043) 4 120260281 147278687 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 724535 Cm18 Cardiac mass QTL 18 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 4 118856416 163856416 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 2302049 Pia32 Pristane induced arthritis QTL 32 5.1 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 105789505 150789505 Rat 724558 Plsm2 Polydactyly-luxate syndrome (PLS) morphotypes QTL 2 0.0003 hindlimb integrity trait (VT:0010563) hind foot phalanges count (CMO:0001949) 4 132422778 177422778 Rat 6478763 Anxrr46 Anxiety related response QTL 46 0.07428 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 6478760 Anxrr45 Anxiety related response QTL 45 0.06717 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 1331802 Srn5 Serum renin concentration QTL 5 3.045 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 4 119428175 157578333 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 7207480 Bss105 Bone structure and strength QTL 105 8.1 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 4 109827074 154827074 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 6478778 Anxrr51 Anxiety related response QTL 51 0.25384 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 124778595 169778595 Rat 61406 Scwia1 Streptococcal cell wall induced arthritis QTL 1 2.3 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 4 106805662 151805662 Rat 631511 Pia7 Pristane induced arthritis QTL 7 4.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 634347 Hcar8 Hepatocarcinoma resistance QTL 8 5.8 liver integrity trait (VT:0010547) liver tumorous lesion area to total liver area ratio (CMO:0001075) 4 123143783 168143783 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 61422 Cia13 Collagen induced arthritis QTL 13 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 132642577 167139601 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 2293840 Kiddil9 Kidney dilation QTL 9 2.9 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 4 120926564 148090731 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 61434 Cia3 Collagen induced arthritis QTL 3 4.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 103194656 148194656 Rat 12798527 Anxrr58 Anxiety related response QTL 58 4.11 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 119463257 147278687 Rat
BF398327
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 133,494,679 - 133,494,926 (+) MAPPER mRatBN7.2 Rnor_6.0 4 133,322,949 - 133,323,195 NCBI Rnor6.0 Rnor_5.0 4 197,804,464 - 197,804,710 UniSTS Rnor5.0 RGSC_v3.4 4 135,760,701 - 135,760,947 UniSTS RGSC3.4 Celera 4 122,338,096 - 122,338,342 UniSTS RH 3.4 Map 4 806.5 UniSTS Cytogenetic Map 4 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000029115 ⟹ ENSRNOP00000030661
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 133,454,555 - 133,495,486 (+) Ensembl Rnor_6.0 Ensembl 4 133,285,552 - 133,323,755 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000084158 ⟹ ENSRNOP00000070896
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 133,477,203 - 133,495,486 (+) Ensembl Rnor_6.0 Ensembl 4 133,286,114 - 133,320,467 (+) Ensembl
RefSeq Acc Id:
NM_001106613 ⟹ NP_001100083
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 135,010,919 - 135,051,844 (+) NCBI mRatBN7.2 4 133,454,555 - 133,495,486 (+) NCBI Rnor_6.0 4 133,285,552 - 133,323,755 (+) NCBI Rnor_5.0 4 197,767,067 - 197,805,270 (+) NCBI RGSC_v3.4 4 135,720,581 - 135,761,507 (+) RGD Celera 4 122,298,049 - 122,338,902 (+) NCBI
Sequence:
TTGGAGGGCTGGTGGTAGCGGCTCGGGGAGGTTCTCGCTCTGTCCGTCTCGCTCCGTCTCTCGCTTTCCCCCGGCTCCCTTCGGGACCCCCCTCCCCGATCGCCGGCGTGTGGCGGAGTGTGTGCGAG
hide sequence
RefSeq Acc Id:
NP_001100083 ⟸ NM_001106613
- UniProtKB:
D4A8H5 (UniProtKB/TrEMBL), B2RZ73 (UniProtKB/TrEMBL)
- Sequence:
MDVERLQEALIDFEKRGKKEVCPVLDQFLCHVAKTGETMIQWSQFKGYFIFKLEKVMDDFRTSAPEPRGPPNPNVEYIPFDEMKERILKIVTGFNGIPFTIQRLCELLTDPRRNYTGTDKFLRGVEKN
hide sequence
Ensembl Acc Id:
ENSRNOP00000030661 ⟸ ENSRNOT00000029115
Ensembl Acc Id:
ENSRNOP00000070896 ⟸ ENSRNOT00000084158
RGD ID: 13693277 Promoter ID: EPDNEW_R3802 Type: single initiation site Name: Ppp4r2_1 Description: protein phosphatase 4, regulatory subunit 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 133,285,646 - 133,285,706 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Ppp4r2
protein phosphatase 4, regulatory subunit 2
Ppp4r2_predicted
protein phosphatase 4, regulatory subunit 2 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Ppp4r2_predicted
protein phosphatase 4, regulatory subunit 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
