Symbol:
Timm21
Name:
translocase of inner mitochondrial membrane 21
RGD ID:
1307279
Description:
Predicted to be involved in mitochondrial cytochrome c oxidase assembly; mitochondrial respiratory chain complex I assembly; and protein import into mitochondrial matrix. Predicted to be located in mitochondrion. Predicted to be part of TIM23 mitochondrial import inner membrane translocase complex. Orthologous to human TIMM21 (translocase of inner mitochondrial membrane 21); PARTICIPATES IN presequence pathway of mitochondrial protein import; INTERACTS WITH 17alpha-ethynylestradiol; 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC307210; MGC94128; mitochondrial import inner membrane translocase subunit Tim21; RGD1307279; similar to RIKEN cDNA 2700002I20; TIM21-like protein, mitochondrial; translocase of inner mitochondrial membrane 21 homolog; translocase of inner mitochondrial membrane 21 homolog (yeast)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 80,589,775 - 80,594,237 (-) NCBI GRCr8 mRatBN7.2 18 78,314,900 - 78,319,362 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 78,314,909 - 78,319,454 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 80,425,523 - 80,429,995 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 81,097,587 - 81,102,059 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 78,933,271 - 78,937,743 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 81,803,165 - 81,807,627 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 81,803,173 - 81,807,627 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 80,841,873 - 80,846,335 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 81,524,258 - 81,528,720 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 81,597,712 - 81,602,170 (-) NCBI Celera 18 76,929,506 - 76,933,968 (-) NCBI Celera Cytogenetic Map 18 q12.3 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Timm21 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 80,589,775 - 80,594,237 (-) NCBI GRCr8 mRatBN7.2 18 78,314,900 - 78,319,362 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 78,314,909 - 78,319,454 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 80,425,523 - 80,429,995 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 81,097,587 - 81,102,059 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 78,933,271 - 78,937,743 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 81,803,165 - 81,807,627 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 81,803,173 - 81,807,627 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 80,841,873 - 80,846,335 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 81,524,258 - 81,528,720 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 81,597,712 - 81,602,170 (-) NCBI Celera 18 76,929,506 - 76,933,968 (-) NCBI Celera Cytogenetic Map 18 q12.3 NCBI
TIMM21 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 18 74,148,523 - 74,160,531 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 18 74,148,523 - 74,160,531 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 18 71,815,758 - 71,827,766 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 18 69,966,726 - 69,977,184 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 18 69,966,824 - 69,977,067 NCBI Celera 18 68,680,277 - 68,690,735 (+) NCBI Celera Cytogenetic Map 18 q22.3 NCBI HuRef 18 68,548,250 - 68,558,708 (+) NCBI HuRef CHM1_1 18 71,810,946 - 71,821,404 (+) NCBI CHM1_1 T2T-CHM13v2.0 18 74,369,489 - 74,381,497 (+) NCBI T2T-CHM13v2.0
Timm21 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 84,964,316 - 84,970,168 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 84,964,316 - 84,969,649 (-) Ensembl GRCm39 Ensembl GRCm38 18 84,946,191 - 84,951,530 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 84,946,191 - 84,951,524 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 85,116,686 - 85,120,916 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 85,081,487 - 85,085,717 (-) NCBI MGSCv36 mm8 Celera 18 86,012,402 - 86,016,632 (-) NCBI Celera Cytogenetic Map 18 E4 NCBI cM Map 18 57.53 NCBI
Timm21 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955402 57,586,998 - 57,599,869 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955402 57,586,651 - 57,598,817 (+) NCBI ChiLan1.0 ChiLan1.0
TIMM21 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 17 91,677,594 - 91,688,618 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 18 77,370,217 - 77,381,166 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 18 67,530,610 - 67,540,966 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 18 70,815,069 - 70,825,425 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 18 70,815,069 - 70,825,436 (+) Ensembl panpan1.1 panPan2
TIMM21 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 5,175,702 - 5,182,096 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 5,175,714 - 5,181,883 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 6,182,962 - 6,189,339 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 4,986,113 - 4,992,490 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 4,986,115 - 4,992,294 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 5,024,903 - 5,031,280 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 4,978,599 - 4,984,976 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 5,149,814 - 5,156,191 (-) NCBI UU_Cfam_GSD_1.0
Timm21 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404944 18,942,780 - 18,950,805 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936616 4,263,464 - 4,272,039 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936616 4,263,912 - 4,271,927 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TIMM21 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 149,845,199 - 149,855,908 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 149,845,189 - 149,855,903 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 166,037,961 - 166,048,650 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TIMM21 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 18 5,735,562 - 5,745,258 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 18 5,734,091 - 5,745,267 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666060 20,137,690 - 20,147,393 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Timm21
.
Predicted Target Of
Count of predictions: 40 Count of miRNA genes: 36 Interacting mature miRNAs: 37 Transcripts: ENSRNOT00000020376 Prediction methods: Miranda Result types: miRGate_prediction
1331733 Bp233 Blood pressure QTL 233 3.97196 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 24796977 79788953 Rat 9589041 Epfw12 Epididymal fat weight QTL 12 17.08 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 18 46640675 83828827 Rat 2303584 Gluco55 Glucose level QTL 55 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 18 48520044 83828827 Rat 8694432 Bw165 Body weight QTL 165 3.81 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 46640675 83828827 Rat 1331741 Bp232 Blood pressure QTL 232 3.59112 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 21372893 83213037 Rat 1298072 Cia26 Collagen induced arthritis QTL 26 3.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 54709769 83828827 Rat 1600373 Mamtr6 Mammary tumor resistance QTL 6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 18 19278901 83218561 Rat 2303571 Bw92 Body weight QTL 92 3 body mass (VT:0001259) body weight (CMO:0000012) 18 48520044 83828827 Rat 6903353 Bp353 Blood pressure QTL 353 2.8 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 59796478 83828827 Rat 1598826 Anxrr20 Anxiety related response QTL 20 3.04 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 18 41432971 83828827 Rat 1578667 Bss21 Bone structure and strength QTL 21 3.5 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 18 11791518 83218561 Rat 2303120 Mamtr8 Mammary tumor resistance QTL 8 0.001 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 18 31359408 83218561 Rat 738008 Hcar14 Hepatocarcinoma resistance QTL 14 4.3 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion number (CMO:0001462) 18 51464733 83218561 Rat 634333 Pia19 Pristane induced arthritis QTL 19 3.4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 73997140 79532029 Rat 724542 Kidm2 Kidney mass QTL 2 2.6 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 18 59172115 83828827 Rat 6903356 Bp354 Blood pressure QTL 354 4.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 59796478 83828827 Rat 631518 Bw11 Body weight QTL 11 2.8 body mass (VT:0001259) body weight (CMO:0000012) 18 35870723 80870723 Rat 61367 Iddm4 Insulin dependent diabetes mellitus QTL 4 2.33 0.0074 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 38192455 83192455 Rat 6893683 Bw110 Body weight QTL 110 2.7 0.002 body mass (VT:0001259) body weight (CMO:0000012) 18 43345022 83828827 Rat 8694366 Abfw8 Abdominal fat weight QTL 8 6.38 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 18 46640675 83828827 Rat 1578661 Bss20 Bone structure and strength QTL 20 3.7 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 18 11791518 83218561 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020376 ⟹ ENSRNOP00000020376
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 78,314,917 - 78,319,454 (-) Ensembl Rnor_6.0 Ensembl 18 81,803,173 - 81,807,627 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000120215 ⟹ ENSRNOP00000088057
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 78,314,909 - 78,319,382 (-) Ensembl
RefSeq Acc Id:
NM_001008343 ⟹ NP_001008344
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 80,589,775 - 80,594,237 (-) NCBI mRatBN7.2 18 78,314,900 - 78,319,362 (-) NCBI Rnor_6.0 18 81,803,165 - 81,807,627 (-) NCBI Rnor_5.0 18 80,841,873 - 80,846,335 (-) NCBI RGSC_v3.4 18 81,524,258 - 81,528,720 (-) RGD Celera 18 76,929,506 - 76,933,968 (-) RGD
Sequence:
GTGAATGTCAGTAGGACGGTAAATAGGGCATTTTAATTCAAGAGAGAGAAAAAAAATAAAGTGTACCTAACTTCTCTTGTAGATTATTCATCTTGATATTCGCCTGACACAGGATGTAATGTGAATGG
hide sequence
RefSeq Acc Id:
XM_063277289 ⟹ XP_063133359
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 80,589,775 - 80,594,024 (-) NCBI
RefSeq Acc Id:
NP_001008344 ⟸ NM_001008343
- Peptide Label:
precursor
- UniProtKB:
Q5U2X7 (UniProtKB/Swiss-Prot), A6K5M3 (UniProtKB/TrEMBL)
- Sequence:
MICAFLRVVRHAEKLHGSLGRQLLLPHFVLTKACLKTQPLRWGLREQKKTVQPRTVLGFTQKTFWTQGPDPRKAKEDSSKQVSINRNQREETGVSTSQKVKEAGRDVTYLIVVLFGVSITGSLLYTIF
hide sequence
Ensembl Acc Id:
ENSRNOP00000020376 ⟸ ENSRNOT00000020376
Ensembl Acc Id:
ENSRNOP00000088057 ⟸ ENSRNOT00000120215
RefSeq Acc Id:
XP_063133359 ⟸ XM_063277289
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A8J0 (UniProtKB/TrEMBL)
RGD ID: 13700896 Promoter ID: EPDNEW_R11420 Type: multiple initiation site Name: Timm21_1 Description: translocase of inner mitochondrial membrane 21 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 18 81,807,649 - 81,807,709 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-15
Timm21
translocase of inner mitochondrial membrane 21
Timm21
translocase of inner mitochondrial membrane 21 homolog (yeast)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2011-12-06
Timm21
translocase of inner mitochondrial membrane 21 homolog (yeast)
RGD1307279
similar to RIKEN cDNA 2700002I20
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
RGD1307279
similar to RIKEN cDNA 2700002I20
RGD1307279_predicted
similar to RIKEN cDNA 2700002I20 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1307279_predicted
similar to RIKEN cDNA 2700002I20 (predicted)
LOC307210_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC307210_predicted
similar to RIKEN cDNA 2700002I20 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
