Symbol:
Mylip
Name:
myosin regulatory light chain interacting protein
RGD ID:
1305761
Description:
Predicted to enable cytoskeletal protein binding activity and ubiquitin protein ligase activity. Predicted to be involved in several processes, including cholesterol homeostasis; negative regulation of low-density lipoprotein particle clearance; and regulation of protein catabolic process. Predicted to be located in cytoplasm; cytoskeleton; and plasma membrane. Orthologous to human MYLIP (myosin regulatory light chain interacting protein); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acetamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
E3 ubiquitin-protein ligase MYLIP; idol; inducible degrader of the LDL-receptor; LOC306825; MIR; RING-type E3 ubiquitin transferase MYLIP
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MYLIP (myosin regulatory light chain interacting protein) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Mylip (myosin regulatory light chain interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mylip (myosin regulatory light chain interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MYLIP (myosin regulatory light chain interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MYLIP (myosin regulatory light chain interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mylip (myosin regulatory light chain interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MYLIP (myosin regulatory light chain interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MYLIP (myosin regulatory light chain interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mylip (myosin regulatory light chain interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
MYLIP (myosin regulatory light chain interacting protein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Mylip (myosin regulatory light chain interacting protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mylipa (myosin regulatory light chain interacting protein a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mylipb (myosin regulatory light chain interacting protein b)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
dnr1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
mylip
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Allele / Splice:
Mylipem2Mcwi
Mylipem3Mcwi
Mylipem1Mcwi
Genetic Models:
SS-Mylipem2Mcwi
SS-Mylipem3Mcwi
SS-Mylipem1Mcwi
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 19,492,826 - 19,514,490 (-) NCBI GRCr8 mRatBN7.2 17 19,286,649 - 19,308,295 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 19,286,650 - 19,308,295 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 19,171,096 - 19,192,723 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 20,774,907 - 20,796,527 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 19,098,217 - 19,119,846 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 19,682,040 - 19,703,681 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 19,682,040 - 19,703,681 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 21,703,590 - 21,725,205 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 25,308,147 - 25,329,887 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 25,312,367 - 25,523,199 (-) NCBI Celera 17 18,989,082 - 19,010,552 (-) NCBI Celera Cytogenetic Map 17 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mylip Rat (-)-epigallocatechin 3-gallate multiple interactions ISO MYLIP (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of MYLIP mRNA CTD PMID:22079256 Mylip Rat 1,2-dimethylhydrazine decreases expression ISO Mylip (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of MYLIP mRNA CTD PMID:22206623 Mylip Rat 1,2-dimethylhydrazine multiple interactions ISO Mylip (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MYLIP mRNA CTD PMID:22206623 Mylip Rat 17beta-estradiol decreases expression ISO MYLIP (Homo sapiens) 6480464 Estradiol results in decreased expression of MYLIP mRNA CTD PMID:19167446 Mylip Rat 17beta-estradiol increases expression ISO Mylip (Mus musculus) 6480464 Estradiol results in increased expression of MYLIP mRNA and Estradiol results in increased expression of MYLIP protein CTD PMID:39298647 Mylip Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO MYLIP (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of MYLIP mRNA CTD PMID:21802500 Mylip Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MYLIP mRNA CTD PMID:33387578 Mylip Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MYLIP mRNA CTD PMID:32109520 Mylip Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Mylip (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression of MYLIP mRNA CTD PMID:25975270 Mylip Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of MYLIP mRNA CTD PMID:22298810 and PMID:34747641 Mylip Rat 2-hydroxypropanoic acid increases expression ISO MYLIP (Homo sapiens) 6480464 Lactic Acid results in increased expression of MYLIP mRNA CTD PMID:30851411 Mylip Rat 2-methylcholine affects expression ISO MYLIP (Homo sapiens) 6480464 beta-methylcholine affects the expression of MYLIP mRNA CTD PMID:21179406 Mylip Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Mylip (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of MYLIP mRNA CTD PMID:25172293 Mylip Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Mylip (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of MYLIP mRNA CTD PMID:26251327 Mylip Rat 4,4'-sulfonyldiphenol increases expression ISO Mylip (Mus musculus) 6480464 bisphenol S results in increased expression of MYLIP mRNA CTD PMID:30951980 Mylip Rat 4,4'-sulfonyldiphenol affects methylation ISO Mylip (Mus musculus) 6480464 bisphenol S affects the methylation of MYLIP gene CTD PMID:31683443 Mylip Rat 5-fluorouracil affects expression ISO MYLIP (Homo sapiens) 6480464 Fluorouracil affects the expression of MYLIP mRNA CTD PMID:16584549 Mylip Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of MYLIP mRNA CTD PMID:30047161 Mylip Rat 8-Br-cAMP decreases expression ISO MYLIP (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in decreased expression of MYLIP mRNA CTD PMID:22079614 Mylip Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of MYLIP mRNA CTD PMID:31881176 Mylip Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of MYLIP mRNA CTD PMID:28959563 Mylip Rat acrylamide increases expression ISO MYLIP (Homo sapiens) 6480464 Acrylamide results in increased expression of MYLIP mRNA CTD PMID:32763439 Mylip Rat afimoxifene decreases expression ISO MYLIP (Homo sapiens) 6480464 afimoxifene results in decreased expression of MYLIP mRNA CTD PMID:16849584 Mylip Rat aflatoxin B1 decreases methylation ISO MYLIP (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of MYLIP gene CTD PMID:27153756 Mylip Rat all-trans-retinoic acid increases expression ISO MYLIP (Homo sapiens) 6480464 Tretinoin results in increased expression of MYLIP mRNA CTD PMID:21934132 Mylip Rat all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of MYLIP mRNA CTD PMID:20488242 Mylip Rat allethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of MYLIP protein CTD PMID:34896426 Mylip Rat Archazolid B decreases expression ISO MYLIP (Homo sapiens) 6480464 archazolid B results in decreased expression of MYLIP mRNA CTD PMID:25218289 Mylip Rat aristolochic acid A increases expression ISO MYLIP (Homo sapiens) 6480464 aristolochic acid I results in increased expression of MYLIP mRNA CTD PMID:33212167 Mylip Rat Aroclor 1254 decreases expression ISO Mylip (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of MYLIP mRNA CTD PMID:25270620 Mylip Rat arsane decreases response to substance ISO MYLIP (Homo sapiens) 6480464 MYLIP mRNA results in decreased susceptibility to Arsenic CTD PMID:17976673 Mylip Rat arsenic atom decreases response to substance ISO MYLIP (Homo sapiens) 6480464 MYLIP mRNA results in decreased susceptibility to Arsenic CTD PMID:17976673 Mylip Rat atrazine increases expression ISO MYLIP (Homo sapiens) 6480464 Atrazine results in increased expression of MYLIP mRNA CTD PMID:22378314 Mylip Rat belinostat increases expression ISO MYLIP (Homo sapiens) 6480464 belinostat results in increased expression of MYLIP mRNA CTD PMID:26272509 Mylip Rat belinostat multiple interactions ISO MYLIP (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MYLIP mRNA CTD PMID:27188386 Mylip Rat benzo[a]pyrene increases expression ISO MYLIP (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of MYLIP mRNA CTD PMID:20064835 more ... Mylip Rat benzo[a]pyrene increases methylation ISO MYLIP (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of MYLIP promoter CTD PMID:27901495 Mylip Rat benzo[a]pyrene increases expression ISO Mylip (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of MYLIP mRNA CTD PMID:22228805 Mylip Rat benzo[a]pyrene diol epoxide I decreases expression ISO MYLIP (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Mylip Rat benzo[a]pyrene diol epoxide I increases expression ISO MYLIP (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Mylip Rat beta-hexachlorocyclohexane decreases expression ISO Mylip (Mus musculus) 6480464 beta-hexachlorocyclohexane results in decreased expression of MYLIP mRNA CTD PMID:25270620 Mylip Rat bis(2-ethylhexyl) phthalate decreases expression ISO MYLIP (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of MYLIP mRNA CTD PMID:37536456 Mylip Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of MYLIP mRNA CTD PMID:25181051 Mylip Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MYLIP mRNA CTD PMID:30816183 and PMID:32528016 Mylip Rat bisphenol A increases expression ISO Mylip (Mus musculus) 6480464 bisphenol A results in increased expression of MYLIP mRNA CTD PMID:30951980 and PMID:34585602 Mylip Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of MYLIP gene CTD PMID:28505145 Mylip Rat bisphenol F increases expression ISO Mylip (Mus musculus) 6480464 bisphenol F results in increased expression of MYLIP mRNA CTD PMID:30951980 Mylip Rat cadmium atom increases expression ISO MYLIP (Homo sapiens) 6480464 Cadmium results in increased expression of MYLIP mRNA CTD PMID:21120746 Mylip Rat cadmium dichloride increases expression ISO MYLIP (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of MYLIP mRNA CTD PMID:38568856 Mylip Rat calcitriol decreases expression ISO MYLIP (Homo sapiens) 6480464 Calcitriol results in decreased expression of MYLIP mRNA CTD PMID:16002434 Mylip Rat carbon nanotube affects expression ISO Mylip (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of MYLIP mRNA CTD PMID:25554681 Mylip Rat carbon nanotube increases expression ISO Mylip (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Mylip Rat carbon nanotube decreases expression ISO Mylip (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of MYLIP mRNA CTD PMID:25554681 Mylip Rat carnosic acid multiple interactions ISO Mylip (Mus musculus) 6480464 salvin inhibits the reaction [sodium arsenite results in decreased expression of MYLIP mRNA] CTD PMID:35202923 Mylip Rat CGP 52608 multiple interactions ISO MYLIP (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to MYLIP gene] CTD PMID:28238834 Mylip Rat chloropicrin increases expression ISO MYLIP (Homo sapiens) 6480464 chloropicrin results in increased expression of MYLIP mRNA CTD PMID:26352163 Mylip Rat chromium(6+) multiple interactions ISO MYLIP (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of MYLIP mRNA CTD PMID:38479592 Mylip Rat chromium(6+) increases expression ISO MYLIP (Homo sapiens) 6480464 chromium hexavalent ion results in increased expression of MYLIP mRNA CTD PMID:30690063 Mylip Rat ciguatoxin CTX1B affects expression ISO Mylip (Mus musculus) 6480464 Ciguatoxins affects the expression of MYLIP mRNA CTD PMID:18353800 Mylip Rat copper atom multiple interactions ISO MYLIP (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of MYLIP mRNA and [NSC 689534 binds to Copper] which results in increased expression of MYLIP mRNA CTD PMID:20971185 and PMID:24690739 Mylip Rat copper(0) multiple interactions ISO MYLIP (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of MYLIP mRNA and [NSC 689534 binds to Copper] which results in increased expression of MYLIP mRNA CTD PMID:20971185 and PMID:24690739 Mylip Rat copper(II) sulfate increases expression ISO MYLIP (Homo sapiens) 6480464 Copper Sulfate results in increased expression of MYLIP mRNA CTD PMID:19549813 Mylip Rat coumestrol decreases expression ISO MYLIP (Homo sapiens) 6480464 Coumestrol results in decreased expression of MYLIP mRNA CTD PMID:19167446 Mylip Rat coumestrol multiple interactions ISO MYLIP (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of MYLIP mRNA CTD PMID:19167446 Mylip Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of MYLIP mRNA CTD PMID:26577399 Mylip Rat cyclosporin A increases expression ISO MYLIP (Homo sapiens) 6480464 Cyclosporine results in increased expression of MYLIP mRNA CTD PMID:25562108 Mylip Rat cyhalothrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of MYLIP protein CTD PMID:34896426 Mylip Rat cypermethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of MYLIP protein CTD PMID:34896426 Mylip Rat cytarabine decreases expression ISO MYLIP (Homo sapiens) 6480464 Cytarabine results in decreased expression of MYLIP mRNA CTD PMID:21198554 Mylip Rat DDE decreases expression ISO MYLIP (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of MYLIP mRNA CTD PMID:38568856 Mylip Rat Dibutyl phosphate affects expression ISO MYLIP (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MYLIP mRNA CTD PMID:37042841 Mylip Rat disulfiram multiple interactions ISO MYLIP (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of MYLIP mRNA CTD PMID:24690739 Mylip Rat dorsomorphin multiple interactions ISO MYLIP (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Mylip Rat doxorubicin increases expression ISO Mylip (Mus musculus) 6480464 Doxorubicin results in increased expression of MYLIP mRNA CTD PMID:25896364 Mylip Rat doxorubicin increases expression ISO MYLIP (Homo sapiens) 6480464 Doxorubicin results in increased expression of MYLIP mRNA CTD PMID:29803840 Mylip Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of MYLIP mRNA CTD PMID:29391264 Mylip Rat Enterolactone multiple interactions ISO MYLIP (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of MYLIP mRNA CTD PMID:19167446 Mylip Rat entinostat increases expression ISO MYLIP (Homo sapiens) 6480464 entinostat results in increased expression of MYLIP mRNA CTD PMID:26272509 Mylip Rat entinostat multiple interactions ISO MYLIP (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MYLIP mRNA CTD PMID:27188386 Mylip Rat ethyl methanesulfonate decreases expression ISO MYLIP (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of MYLIP mRNA CTD PMID:23649840 Mylip Rat fenvalerate multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of MYLIP protein CTD PMID:34896426 Mylip Rat folic acid multiple interactions ISO Mylip (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MYLIP mRNA CTD PMID:22206623 Mylip Rat folic acid decreases expression ISO Mylip (Mus musculus) 6480464 Folic Acid results in decreased expression of MYLIP mRNA CTD PMID:25629700 Mylip Rat formaldehyde increases expression ISO MYLIP (Homo sapiens) 6480464 Formaldehyde results in increased expression of MYLIP mRNA CTD PMID:20655997 and PMID:23649840 Mylip Rat furan increases expression EXP 6480464 furan results in increased expression of MYLIP mRNA CTD PMID:27387713 Mylip Rat genistein increases expression ISO MYLIP (Homo sapiens) 6480464 Genistein results in increased expression of MYLIP mRNA CTD PMID:18847459 Mylip Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of MYLIP mRNA CTD PMID:22061828 Mylip Rat glyphosate decreases expression ISO Mylip (Mus musculus) 6480464 Glyphosate results in decreased expression of MYLIP mRNA CTD PMID:35897073 Mylip Rat GW 3965 increases expression ISO MYLIP (Homo sapiens) 6480464 GW 3965 results in increased expression of MYLIP mRNA CTD PMID:27598782 Mylip Rat GW 4064 decreases expression ISO MYLIP (Homo sapiens) 6480464 GW 4064 results in decreased expression of MYLIP mRNA CTD PMID:31437187 Mylip Rat Heptachlor epoxide decreases expression ISO Mylip (Mus musculus) 6480464 Heptachlor Epoxide results in decreased expression of MYLIP mRNA CTD PMID:25270620 Mylip Rat hydroquinone decreases expression ISO MYLIP (Homo sapiens) 6480464 hydroquinone results in decreased expression of MYLIP mRNA CTD PMID:31256213 Mylip Rat isoprenaline increases expression ISO Mylip (Mus musculus) 6480464 Isoproterenol results in increased expression of MYLIP mRNA CTD PMID:20003209 Mylip Rat lead(0) affects expression ISO MYLIP (Homo sapiens) 6480464 Lead affects the expression of MYLIP mRNA CTD PMID:22313790 and PMID:28903495 Mylip Rat Licochalcone B increases expression ISO MYLIP (Homo sapiens) 6480464 licochalcone B results in increased expression of MYLIP mRNA CTD PMID:33647349 Mylip Rat maneb multiple interactions ISO Mylip (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of MYLIP mRNA CTD PMID:36117858 Mylip Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of MYLIP mRNA CTD PMID:30047161 Mylip Rat methyl methanesulfonate increases expression ISO MYLIP (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of MYLIP mRNA CTD PMID:23649840 Mylip Rat methylisothiazolinone increases expression ISO MYLIP (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of MYLIP mRNA CTD PMID:31629900 Mylip Rat methylmercury chloride increases expression ISO MYLIP (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of MYLIP mRNA CTD PMID:28001369 Mylip Rat mifepristone decreases expression EXP 6480464 Mifepristone results in decreased expression of MYLIP mRNA CTD PMID:25972201 Mylip Rat mitomycin C affects response to substance ISO MYLIP (Homo sapiens) 6480464 MYLIP protein affects the susceptibility to Mitomycin CTD PMID:16217747 Mylip Rat nickel sulfate increases expression ISO MYLIP (Homo sapiens) 6480464 nickel sulfate results in increased expression of MYLIP mRNA CTD PMID:22714537 Mylip Rat ozone multiple interactions ISO Mylip (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of MYLIP mRNA CTD PMID:34911549 Mylip Rat p-chloromercuribenzoic acid increases expression ISO MYLIP (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of MYLIP mRNA CTD PMID:26272509 Mylip Rat p-chloromercuribenzoic acid multiple interactions ISO MYLIP (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MYLIP mRNA CTD PMID:27188386 Mylip Rat panobinostat multiple interactions ISO MYLIP (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MYLIP mRNA CTD PMID:27188386 Mylip Rat panobinostat increases expression ISO MYLIP (Homo sapiens) 6480464 panobinostat results in increased expression of MYLIP mRNA CTD PMID:26272509 Mylip Rat paracetamol increases expression ISO MYLIP (Homo sapiens) 6480464 Acetaminophen results in increased expression of MYLIP mRNA CTD PMID:21420995 and PMID:29067470 Mylip Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of MYLIP mRNA CTD PMID:33387578 Mylip Rat paraquat multiple interactions ISO Mylip (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of MYLIP mRNA CTD PMID:36117858 Mylip Rat phenobarbital decreases expression ISO Mylip (Mus musculus) 6480464 Phenobarbital results in decreased expression of MYLIP mRNA CTD PMID:19482888 Mylip Rat phenobarbital affects expression ISO Mylip (Mus musculus) 6480464 Phenobarbital affects the expression of MYLIP mRNA CTD PMID:23091169 Mylip Rat phenobarbital multiple interactions ISO Mylip (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of MYLIP mRNA] CTD PMID:19482888 Mylip Rat potassium chromate multiple interactions ISO MYLIP (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of MYLIP mRNA CTD PMID:22079256 Mylip Rat potassium chromate increases expression ISO MYLIP (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of MYLIP mRNA CTD PMID:22079256 and PMID:22714537 Mylip Rat progesterone increases expression ISO MYLIP (Homo sapiens) 6480464 Progesterone results in increased expression of MYLIP mRNA CTD PMID:18037150 Mylip Rat progesterone decreases expression ISO MYLIP (Homo sapiens) 6480464 Progesterone results in decreased expression of MYLIP mRNA CTD PMID:21795739 Mylip Rat pyrethrins decreases expression EXP 6480464 Pyrethrins results in decreased expression of MYLIP protein CTD PMID:34896426 Mylip Rat quercetin increases expression ISO MYLIP (Homo sapiens) 6480464 Quercetin results in increased expression of MYLIP mRNA CTD PMID:21632981 Mylip Rat rac-lactic acid increases expression ISO MYLIP (Homo sapiens) 6480464 Lactic Acid results in increased expression of MYLIP mRNA CTD PMID:30851411 Mylip Rat SB 431542 multiple interactions ISO MYLIP (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Mylip Rat sodium arsenite decreases expression ISO Mylip (Mus musculus) 6480464 sodium arsenite results in decreased expression of MYLIP mRNA CTD PMID:35202923 Mylip Rat sodium arsenite increases expression ISO MYLIP (Homo sapiens) 6480464 sodium arsenite results in increased expression of MYLIP mRNA CTD PMID:38568856 Mylip Rat sodium arsenite multiple interactions ISO Mylip (Mus musculus) 6480464 salvin inhibits the reaction [sodium arsenite results in decreased expression of MYLIP mRNA] CTD PMID:35202923 Mylip Rat sodium dichromate increases expression ISO MYLIP (Homo sapiens) 6480464 sodium bichromate results in increased expression of MYLIP mRNA CTD PMID:17685462 Mylip Rat Soman increases expression EXP 6480464 Soman results in increased expression of MYLIP mRNA CTD PMID:19281266 Mylip Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of MYLIP mRNA CTD PMID:30047161 Mylip Rat sunitinib increases expression ISO MYLIP (Homo sapiens) 6480464 Sunitinib results in increased expression of MYLIP mRNA CTD PMID:31533062 Mylip Rat temozolomide increases expression ISO MYLIP (Homo sapiens) 6480464 Temozolomide results in increased expression of MYLIP mRNA CTD PMID:31758290 Mylip Rat testosterone increases expression ISO Mylip (Mus musculus) 6480464 Testosterone deficiency results in increased expression of MYLIP mRNA CTD PMID:33848595 Mylip Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of MYLIP mRNA CTD PMID:34492290 Mylip Rat thiram increases expression ISO MYLIP (Homo sapiens) 6480464 Thiram results in increased expression of MYLIP mRNA CTD PMID:38568856 Mylip Rat titanium dioxide increases methylation ISO Mylip (Mus musculus) 6480464 titanium dioxide results in increased methylation of MYLIP gene CTD PMID:35295148 Mylip Rat titanium dioxide decreases methylation ISO Mylip (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MYLIP promoter CTD PMID:35295148 Mylip Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of MYLIP gene CTD PMID:27618143 Mylip Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of MYLIP mRNA CTD PMID:33387578 Mylip Rat trichostatin A increases expression ISO MYLIP (Homo sapiens) 6480464 trichostatin A results in increased expression of MYLIP mRNA CTD PMID:24935251 and PMID:26272509 Mylip Rat trichostatin A multiple interactions ISO MYLIP (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MYLIP mRNA CTD PMID:27188386 Mylip Rat triclosan increases expression ISO MYLIP (Homo sapiens) 6480464 Triclosan results in increased expression of MYLIP mRNA CTD PMID:30510588 Mylip Rat triphenyl phosphate affects expression ISO MYLIP (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MYLIP mRNA CTD PMID:37042841 Mylip Rat triptonide increases expression ISO Mylip (Mus musculus) 6480464 triptonide results in increased expression of MYLIP mRNA CTD PMID:33045310 Mylip Rat tunicamycin decreases expression ISO MYLIP (Homo sapiens) 6480464 Tunicamycin results in decreased expression of MYLIP mRNA CTD PMID:22378314 Mylip Rat urethane increases expression ISO MYLIP (Homo sapiens) 6480464 Urethane results in increased expression of MYLIP mRNA CTD PMID:28818685 Mylip Rat valproic acid affects expression ISO Mylip (Mus musculus) 6480464 Valproic Acid affects the expression of MYLIP mRNA CTD PMID:17292431 Mylip Rat valproic acid multiple interactions ISO MYLIP (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MYLIP mRNA CTD PMID:27188386 Mylip Rat valproic acid increases expression ISO MYLIP (Homo sapiens) 6480464 Valproic Acid results in increased expression of MYLIP mRNA CTD PMID:23179753 more ... Mylip Rat valproic acid affects expression ISO MYLIP (Homo sapiens) 6480464 Valproic Acid affects the expression of MYLIP mRNA CTD PMID:25979313 Mylip Rat valproic acid increases expression ISO Mylip (Mus musculus) 6480464 Valproic Acid results in increased expression of MYLIP mRNA CTD PMID:19136453 and PMID:21427059 Mylip Rat zinc atom multiple interactions ISO MYLIP (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of MYLIP mRNA CTD PMID:18593933 Mylip Rat zinc(0) multiple interactions ISO MYLIP (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of MYLIP mRNA CTD PMID:18593933
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) 8-Br-cAMP (ISO) acetamide (EXP) acrylamide (EXP,ISO) afimoxifene (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP,ISO) allethrin (EXP) Archazolid B (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) belinostat (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-hexachlorocyclohexane (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (ISO) calcitriol (ISO) carbon nanotube (ISO) carnosic acid (ISO) CGP 52608 (ISO) chloropicrin (ISO) chromium(6+) (ISO) ciguatoxin CTX1B (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) coumestrol (ISO) Cuprizon (EXP) cyclosporin A (ISO) cyhalothrin (EXP) cypermethrin (EXP) cytarabine (ISO) DDE (ISO) Dibutyl phosphate (ISO) disulfiram (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) Enterolactone (ISO) entinostat (ISO) ethyl methanesulfonate (ISO) fenvalerate (EXP) folic acid (ISO) formaldehyde (ISO) furan (EXP) genistein (ISO) gentamycin (EXP) glyphosate (ISO) GW 3965 (ISO) GW 4064 (ISO) Heptachlor epoxide (ISO) hydroquinone (ISO) isoprenaline (ISO) lead(0) (ISO) Licochalcone B (ISO) maneb (ISO) methimazole (EXP) methyl methanesulfonate (ISO) methylisothiazolinone (ISO) methylmercury chloride (ISO) mifepristone (EXP) mitomycin C (ISO) nickel sulfate (ISO) ozone (ISO) p-chloromercuribenzoic acid (ISO) panobinostat (ISO) paracetamol (EXP,ISO) paraquat (ISO) phenobarbital (ISO) potassium chromate (ISO) progesterone (ISO) pyrethrins (EXP) quercetin (ISO) rac-lactic acid (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium dichromate (ISO) Soman (EXP) sulfadimethoxine (EXP) sunitinib (ISO) temozolomide (ISO) testosterone (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) triphenyl phosphate (ISO) triptonide (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
cholesterol homeostasis (IEA,ISO) negative regulation of low-density lipoprotein particle clearance (IEA,ISO) negative regulation of neuron projection development (IEA,ISO) nervous system development (IEA,ISO) positive regulation of protein catabolic process (IEA,ISO) protein destabilization (IEA,ISO) protein ubiquitination (IEA,ISO) regulation of low-density lipoprotein particle receptor catabolic process (IEA,ISO) ubiquitin-dependent protein catabolic process (IBA,IEA,ISO)
Mylip Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 19,492,826 - 19,514,490 (-) NCBI GRCr8 mRatBN7.2 17 19,286,649 - 19,308,295 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 19,286,650 - 19,308,295 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 19,171,096 - 19,192,723 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 20,774,907 - 20,796,527 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 19,098,217 - 19,119,846 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 19,682,040 - 19,703,681 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 19,682,040 - 19,703,681 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 21,703,590 - 21,725,205 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 25,308,147 - 25,329,887 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 25,312,367 - 25,523,199 (-) NCBI Celera 17 18,989,082 - 19,010,552 (-) NCBI Celera Cytogenetic Map 17 p14 NCBI
MYLIP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 16,129,086 - 16,163,887 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 16,129,086 - 16,151,367 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 16,129,317 - 16,148,479 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 16,237,296 - 16,256,458 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 16,237,295 - 16,256,455 NCBI Celera 6 17,367,147 - 17,386,309 (+) NCBI Celera Cytogenetic Map 6 p22.3 NCBI HuRef 6 16,076,513 - 16,095,715 (+) NCBI HuRef CHM1_1 6 16,132,017 - 16,151,181 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 16,001,663 - 16,037,439 (+) NCBI T2T-CHM13v2.0
Mylip Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 45,543,197 - 45,565,498 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 45,543,218 - 45,565,498 (+) Ensembl GRCm39 Ensembl GRCm38 13 45,389,742 - 45,411,940 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 45,389,742 - 45,412,022 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 45,485,111 - 45,507,309 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 45,400,714 - 45,422,912 (+) NCBI MGSCv36 mm8 Celera 13 46,464,431 - 46,486,733 (+) NCBI Celera Cytogenetic Map 13 A5 NCBI cM Map 13 21.88 NCBI
Mylip Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955483 9,723,023 - 9,745,062 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955483 9,725,343 - 9,745,041 (-) NCBI ChiLan1.0 ChiLan1.0
MYLIP Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 30,794,914 - 30,816,026 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 26,780,496 - 26,801,629 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 15,985,844 - 16,005,043 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 16,350,852 - 16,370,253 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 16,350,852 - 16,370,253 (+) Ensembl panpan1.1 panPan2
MYLIP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 35 15,257,633 - 15,276,771 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 35 15,256,885 - 15,275,424 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 35 15,205,869 - 15,225,698 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 35 15,352,342 - 15,372,171 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 35 15,352,164 - 15,370,824 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 35 15,177,056 - 15,196,883 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 35 15,228,888 - 15,248,707 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 35 16,555,131 - 16,574,958 (+) NCBI UU_Cfam_GSD_1.0
Mylip Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 9,389,585 - 9,405,771 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936552 2,325,378 - 2,339,867 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936552 2,325,161 - 2,341,356 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MYLIP Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 12,117,240 - 12,137,925 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 12,117,240 - 12,137,934 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 12,713,066 - 12,733,740 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MYLIP Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 56,021,151 - 56,040,175 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 56,022,369 - 56,040,169 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 16,181,768 - 16,200,965 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mylip
.
Predicted Target Of
Count of predictions: 223 Count of miRNA genes: 153 Interacting mature miRNAs: 181 Transcripts: ENSRNOT00000024021 Prediction methods: Miranda, Pita, Rnahybrid, Targetscan Result types: miRGate_prediction
1354581 Bp247 Blood pressure QTL 247 4.5 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 17 1 43999106 Rat 2300002 Iddm36 Insulin dependent diabetes mellitus QTL 36 1.98 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 17 9266755 40968173 Rat 2293664 Bmd28 Bone mineral density QTL 28 5.1 0.0001 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 17 4360057 27233623 Rat 8552966 Pigfal18 Plasma insulin-like growth factor 1 level QTL 18 8.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 17 12860942 57860942 Rat 1300123 Bp194 Blood pressure QTL 194 2.82 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 2120843 42054133 Rat 1582224 Epfw4 Epididymal fat weight QTL 4 3.5 0.0058 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 17 9206505 23859062 Rat 1582225 Bw67 Body weight QTL 67 6.2 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 17 9206505 23859062 Rat 2302377 Scl61 Serum cholesterol level QTL 61 4.36 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 17 6221998 58177198 Rat 1582226 Bw64 Body weight QTL 64 4.2 0.0017 body mass (VT:0001259) body weight (CMO:0000012) 17 9206505 23859062 Rat 9589151 Insul30 Insulin level QTL 30 8.82 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 17 12860942 57860942 Rat 10401807 Kidm52 Kidney mass QTL 52 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 17 1 31706603 Rat 10054088 Scort28 Serum corticosterone level QTL 28 2.04 0.0102 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 17 4733534 49733534 Rat 9589057 Scfw6 Subcutaneous fat weight QTL 6 8.62 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 17 12860942 57860942 Rat 1582208 Kidm32 Kidney mass QTL 32 3.9 0.0018 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 17 9206505 23859062 Rat 9590154 Scort9 Serum corticosterone level QTL 9 23.57 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 17 12860942 57860942 Rat 9590088 Insglur7 Insulin/glucose ratio QTL 7 20.38 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 17 12860942 57860942 Rat 1549900 Iddm20 Insulin dependent diabetes mellitus QTL 20 3.7 pancreas integrity trait (VT:0010560) percentage of study population developing diabetes mellitus during a period of time (CMO:0001114) 17 1 22181410 Rat 1331720 Rf43 Renal function QTL 43 2.881 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 17 15537025 28637951 Rat 2317053 Aia25 Adjuvant induced arthritis QTL 25 2.69 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 17 10604694 55604694 Rat 1354613 Kidm14 Kidney mass QTL 14 6.2 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 17 1 36045694 Rat 1331765 Hrtrt15 Heart rate QTL 15 4.094 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 17 15537025 60531414 Rat 7411666 Foco31 Food consumption QTL 31 11.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 17 12860942 57860942 Rat 2324619 Coatc4 Coat color QTL 4 0.001 coat/hair pigmentation trait (VT:0010463) pigmented dorsal coat/hair area to total dorsal coat/hair area ratio (CMO:0001811) 17 1 21499218 Rat 2303627 Vencon8 Ventilatory control QTL 8 0.001 respiration trait (VT:0001943) tidal volume (CMO:0000222) 17 4733534 49733534 Rat 70184 BpQTLcluster14 Blood pressure QTL cluster 14 3.38 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 8574342 32199534 Rat 1582258 Bw76 Body weight QTL 76 4.6 0.0005 body mass (VT:0001259) body weight (CMO:0000012) 17 9206505 23859062 Rat 631207 Niddm41 Non-insulin dependent diabetes mellitus QTL 41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 17 1 38037084 Rat 1582199 Insul5 Insulin level QTL 5 3.4 0.0119 blood insulin amount (VT:0001560) calculated serum insulin level (CMO:0000359) 17 9206505 23859062 Rat 1354662 Rf49 Renal function QTL 49 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 17 1 43999106 Rat 2293648 Bmd31 Bone mineral density QTL 31 4.5 0.0001 femur size trait (VT:1000369) femoral neck cortical cross-sectional area (CMO:0001702) 17 4360057 27233623 Rat 1354658 Spl8 Serum phospholipid level QTL 8 3.8 blood VLDL phospholipid amount (VT:0010507) blood very low density lipoprotein phospholipid level (CMO:0001571) 17 1 43999106 Rat 1641902 Colcr7 Colorectal carcinoma resistance QTL 7 3.35 0.0044 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 17 2120843 22087569 Rat 1582241 Bw70 Body weight QTL 70 4.6 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 17 9206505 23859062 Rat 1582245 Bw73 Body weight QTL 73 4.6 0.0004 body mass (VT:0001259) body weight (CMO:0000012) 17 9206505 23859062 Rat 9590316 Scort21 Serum corticosterone level QTL 21 4.75 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 17 1 22877318 Rat
AA818380
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 19,286,948 - 19,287,129 (+) MAPPER mRatBN7.2 Rnor_6.0 17 19,682,339 - 19,682,519 NCBI Rnor6.0 Rnor_5.0 17 21,703,889 - 21,704,069 UniSTS Rnor5.0 RGSC_v3.4 17 25,308,439 - 25,308,619 UniSTS RGSC3.4 Celera 17 18,989,381 - 18,989,561 UniSTS RH 3.4 Map 17 246.9 UniSTS Cytogenetic Map 17 p12 UniSTS
AI411450
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 19,306,413 - 19,306,595 (+) MAPPER mRatBN7.2 Rnor_6.0 17 19,701,801 - 19,701,982 NCBI Rnor6.0 Rnor_5.0 17 21,723,325 - 21,723,506 UniSTS Rnor5.0 RGSC_v3.4 17 25,328,007 - 25,328,188 UniSTS RGSC3.4 Celera 17 19,008,667 - 19,008,848 UniSTS RH 3.4 Map 17 248.8 UniSTS Cytogenetic Map 17 p12 UniSTS
This gene Mylip is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024021 ⟹ ENSRNOP00000024021
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 19,286,650 - 19,308,295 (-) Ensembl Rnor_6.0 Ensembl 17 19,682,040 - 19,703,681 (-) Ensembl
RefSeq Acc Id:
NM_001107344 ⟹ NP_001100814
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 19,492,826 - 19,514,471 (-) NCBI mRatBN7.2 17 19,286,650 - 19,308,295 (-) NCBI Rnor_6.0 17 19,682,040 - 19,703,681 (-) NCBI Rnor_5.0 17 21,703,590 - 21,725,205 (-) NCBI RGSC_v3.4 17 25,308,147 - 25,329,887 (-) RGD Celera 17 18,989,082 - 19,010,552 (-) NCBI
Sequence:
CAGTGGGGCTGTCGGAGCGGCGCGGCCGTGTAGCTCCCGGGAACTGGCTGTCGTGGGGGGTGGCGGGGACGCGAGTGGCGGCTGCGTGGGGTGCAGGGCGGGTGACCGCACGGCTGCACCTTCCTCGC
hide sequence
RefSeq Acc Id:
XM_063276374 ⟹ XP_063132444
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 19,492,830 - 19,514,490 (-) NCBI
RefSeq Acc Id:
XM_063276375 ⟹ XP_063132445
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 19,492,830 - 19,500,989 (-) NCBI
RefSeq Acc Id:
NP_001100814 ⟸ NM_001107344
- UniProtKB:
D3ZDI6 (UniProtKB/Swiss-Prot)
- Sequence:
MLCYVTRPDAVLMEVEVEAKANGEDCLNQVCRRLGIIEVDYFGLQFTGSKGESLWLNLRNRISQQMDGLAPYRLKLRVKFFVEPHLILQEQTRHIFFLHIKESLLAGHLQCSPEQAVELSALLAQTKF
hide sequence
Ensembl Acc Id:
ENSRNOP00000024021 ⟸ ENSRNOT00000024021
RefSeq Acc Id:
XP_063132444 ⟸ XM_063276374
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063132445 ⟸ XM_063276375
- Peptide Label:
isoform X2
RGD ID: 13700372 Promoter ID: EPDNEW_R10895 Type: single initiation site Name: Mylip_1 Description: myosin regulatory light chain interacting protein SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 17 19,703,680 - 19,703,740 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Mylip
myosin regulatory light chain interacting protein
Mylip_predicted
myosin regulatory light chain interacting protein (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Mylip_predicted
myosin regulatory light chain interacting protein (predicted)
Symbol and Name status set to approved
70820 APPROVED
