Symbol:
Mrpl15
Name:
mitochondrial ribosomal protein L15
RGD ID:
1304796
Description:
Predicted to be a structural constituent of ribosome. Predicted to be involved in translation. Predicted to act upstream of or within cellular response to leukemia inhibitory factor. Predicted to be located in mitochondrion. Predicted to be part of mitochondrial large ribosomal subunit. Orthologous to human MRPL15 (mitochondrial ribosomal protein L15); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
39S ribosomal protein L15, mitochondrial; large ribosomal subunit protein uL15m; LOC297799
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 19,527,745 - 19,539,061 (+) NCBI GRCr8 mRatBN7.2 5 14,729,961 - 14,741,276 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 14,729,979 - 14,741,276 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 16,924,207 - 16,935,288 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 18,537,717 - 18,548,790 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 18,258,877 - 18,269,950 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 14,609,656 - 14,620,965 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 14,609,674 - 14,620,965 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 19,392,153 - 19,403,455 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 14,932,623 - 14,943,904 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 14,932,590 - 14,941,120 (+) NCBI Celera 5 14,101,085 - 14,112,172 (+) NCBI Celera Cytogenetic Map 5 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mrpl15 Rat (1->4)-beta-D-glucan multiple interactions ISO Mrpl15 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of MRPL15 mRNA CTD PMID:36331819 Mrpl15 Rat 1,2-dichloroethane increases expression ISO Mrpl15 (Mus musculus) 6480464 ethylene dichloride results in increased expression of MRPL15 mRNA CTD PMID:28960355 Mrpl15 Rat 1,2-dimethylhydrazine decreases expression ISO Mrpl15 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of MRPL15 mRNA CTD PMID:22206623 Mrpl15 Rat 17alpha-ethynylestradiol increases expression ISO Mrpl15 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of MRPL15 mRNA CTD PMID:17942748 Mrpl15 Rat 17alpha-ethynylestradiol multiple interactions ISO Mrpl15 (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of MRPL15 mRNA and [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MRPL15 mRNA CTD PMID:17942748 and PMID:37844793 Mrpl15 Rat 17beta-estradiol affects expression ISO Mrpl15 (Mus musculus) 6480464 Estradiol affects the expression of MRPL15 mRNA CTD PMID:39298647 Mrpl15 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Mrpl15 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MRPL15 mRNA CTD PMID:17942748 Mrpl15 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MRPL15 mRNA CTD PMID:33387578 Mrpl15 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mrpl15 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MRPL15 mRNA CTD PMID:21570461 Mrpl15 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Mrpl15 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of MRPL15 mRNA CTD PMID:19465110 Mrpl15 Rat 2-hydroxypropanoic acid decreases expression ISO MRPL15 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of MRPL15 mRNA CTD PMID:30851411 Mrpl15 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of MRPL15 protein CTD PMID:34915118 Mrpl15 Rat 4,4'-sulfonyldiphenol increases expression ISO Mrpl15 (Mus musculus) 6480464 bisphenol S results in increased expression of MRPL15 mRNA CTD PMID:39298647 Mrpl15 Rat 4,4'-sulfonyldiphenol affects expression ISO MRPL15 (Homo sapiens) 6480464 bisphenol S affects the expression of MRPL15 protein CTD PMID:31945527 Mrpl15 Rat 4-hydroxyphenyl retinamide increases expression ISO Mrpl15 (Mus musculus) 6480464 Fenretinide results in increased expression of MRPL15 mRNA CTD PMID:28973697 Mrpl15 Rat all-trans-retinoic acid decreases expression ISO Mrpl15 (Mus musculus) 6480464 Tretinoin results in decreased expression of MRPL15 mRNA CTD PMID:16788091 Mrpl15 Rat all-trans-retinoic acid decreases expression ISO MRPL15 (Homo sapiens) 6480464 Tretinoin results in decreased expression of MRPL15 mRNA CTD PMID:23724009 and PMID:33167477 Mrpl15 Rat arsane multiple interactions ISO MRPL15 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MRPL15 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MRPL15 mRNA CTD PMID:39836092 Mrpl15 Rat arsenic atom multiple interactions ISO MRPL15 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MRPL15 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MRPL15 mRNA CTD PMID:39836092 Mrpl15 Rat atrazine decreases expression ISO MRPL15 (Homo sapiens) 6480464 Atrazine results in decreased expression of MRPL15 mRNA CTD PMID:22378314 Mrpl15 Rat benzo[a]pyrene decreases methylation ISO MRPL15 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of MRPL15 promoter CTD PMID:27901495 Mrpl15 Rat benzo[a]pyrene diol epoxide I decreases expression ISO MRPL15 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Mrpl15 Rat bis(2-ethylhexyl) phthalate increases expression ISO Mrpl15 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of MRPL15 mRNA CTD PMID:19850644 Mrpl15 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Mrpl15 (Mus musculus) 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of MRPL15 mRNA] CTD PMID:19850644 Mrpl15 Rat bisphenol A decreases expression ISO Mrpl15 (Mus musculus) 6480464 bisphenol A results in decreased expression of MRPL15 mRNA CTD PMID:26063408 Mrpl15 Rat bisphenol A increases expression ISO MRPL15 (Homo sapiens) 6480464 bisphenol A results in increased expression of MRPL15 protein CTD PMID:37567409 Mrpl15 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MRPL15 mRNA CTD PMID:34947998 Mrpl15 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MRPL15 mRNA CTD PMID:25181051 Mrpl15 Rat bisphenol AF increases expression ISO MRPL15 (Homo sapiens) 6480464 bisphenol AF results in increased expression of MRPL15 protein CTD PMID:34186270 Mrpl15 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of MRPL15 mRNA CTD PMID:24136188 Mrpl15 Rat cadmium atom multiple interactions ISO MRPL15 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of MRPL15 mRNA CTD PMID:35301059 Mrpl15 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of MRPL15 promoter CTD PMID:22457795 Mrpl15 Rat cadmium dichloride multiple interactions ISO MRPL15 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of MRPL15 mRNA CTD PMID:35301059 Mrpl15 Rat cadmium dichloride decreases expression ISO MRPL15 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of MRPL15 mRNA CTD PMID:38568856 Mrpl15 Rat carbon nanotube decreases expression ISO Mrpl15 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Mrpl15 Rat carbon nanotube increases expression ISO Mrpl15 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Mrpl15 Rat copper(II) sulfate decreases expression ISO MRPL15 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of MRPL15 mRNA CTD PMID:19549813 Mrpl15 Rat crocidolite asbestos decreases expression ISO Mrpl15 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of MRPL15 mRNA CTD PMID:29279043 Mrpl15 Rat DDE increases expression ISO MRPL15 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of MRPL15 mRNA CTD PMID:38568856 Mrpl15 Rat dibenzo[a,l]pyrene decreases expression ISO Mrpl15 (Mus musculus) 6480464 dibenzo(a and l)pyrene results in decreased expression of MRPL15 mRNA CTD PMID:25908611 Mrpl15 Rat Dibutyl phosphate affects expression ISO MRPL15 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MRPL15 mRNA CTD PMID:37042841 Mrpl15 Rat dibutyl phthalate decreases expression ISO Mrpl15 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of MRPL15 mRNA CTD PMID:21266533 Mrpl15 Rat diclofenac multiple interactions ISO Mrpl15 (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of MRPL15 mRNA CTD PMID:37844793 Mrpl15 Rat dicrotophos decreases expression ISO MRPL15 (Homo sapiens) 6480464 dicrotophos results in decreased expression of MRPL15 mRNA CTD PMID:28302478 Mrpl15 Rat dorsomorphin multiple interactions ISO MRPL15 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MRPL15 mRNA CTD PMID:27188386 Mrpl15 Rat ethanol increases expression ISO Mrpl15 (Mus musculus) 6480464 Ethanol results in increased expression of MRPL15 mRNA CTD PMID:30319688 Mrpl15 Rat ibuprofen multiple interactions ISO Mrpl15 (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of MRPL15 mRNA CTD PMID:37844793 Mrpl15 Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of MRPL15 mRNA CTD PMID:36868495 Mrpl15 Rat inulin multiple interactions ISO Mrpl15 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of MRPL15 mRNA CTD PMID:36331819 Mrpl15 Rat ivermectin decreases expression ISO MRPL15 (Homo sapiens) 6480464 Ivermectin results in decreased expression of MRPL15 protein CTD PMID:32959892 Mrpl15 Rat lead(0) affects expression ISO MRPL15 (Homo sapiens) 6480464 Lead affects the expression of MRPL15 mRNA CTD PMID:28903495 Mrpl15 Rat maneb multiple interactions ISO Mrpl15 (Mus musculus) 6480464 [Paraquat co-treated with Maneb] results in decreased expression of MRPL15 mRNA CTD PMID:18386188 Mrpl15 Rat manganese atom multiple interactions ISO MRPL15 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MRPL15 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of MRPL15 mRNA CTD PMID:39836092 Mrpl15 Rat manganese(0) multiple interactions ISO MRPL15 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MRPL15 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of MRPL15 mRNA CTD PMID:39836092 Mrpl15 Rat manganese(II) chloride multiple interactions ISO MRPL15 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MRPL15 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of MRPL15 mRNA CTD PMID:39836092 Mrpl15 Rat paracetamol affects expression ISO Mrpl15 (Mus musculus) 6480464 Acetaminophen affects the expression of MRPL15 mRNA CTD PMID:17562736 Mrpl15 Rat paracetamol decreases expression ISO MRPL15 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of MRPL15 mRNA CTD PMID:22230336 more ... Mrpl15 Rat paraquat multiple interactions ISO Mrpl15 (Mus musculus) 6480464 [Paraquat co-treated with Maneb] results in decreased expression of MRPL15 mRNA CTD PMID:18386188 Mrpl15 Rat paraquat increases expression ISO Mrpl15 (Mus musculus) 6480464 Paraquat results in increased expression of MRPL15 mRNA CTD PMID:21463325 Mrpl15 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Mrpl15 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of MRPL15 mRNA more ... CTD PMID:36331819 Mrpl15 Rat phenobarbital affects expression ISO Mrpl15 (Mus musculus) 6480464 Phenobarbital affects the expression of MRPL15 mRNA CTD PMID:23091169 Mrpl15 Rat propiconazole increases expression ISO Mrpl15 (Mus musculus) 6480464 propiconazole results in increased expression of MRPL15 mRNA CTD PMID:21278054 Mrpl15 Rat rac-lactic acid decreases expression ISO MRPL15 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of MRPL15 mRNA CTD PMID:30851411 Mrpl15 Rat resveratrol increases expression ISO Mrpl15 (Mus musculus) 6480464 resveratrol results in increased expression of MRPL15 mRNA CTD PMID:22610192 Mrpl15 Rat resveratrol multiple interactions ISO MRPL15 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of MRPL15 mRNA CTD PMID:23557933 Mrpl15 Rat SB 431542 multiple interactions ISO MRPL15 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MRPL15 mRNA CTD PMID:27188386 Mrpl15 Rat silicon dioxide decreases expression ISO Mrpl15 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of MRPL15 mRNA CTD PMID:19073995 Mrpl15 Rat sodium arsenite decreases expression ISO Mrpl15 (Mus musculus) 6480464 sodium arsenite results in decreased expression of MRPL15 mRNA CTD PMID:16014739 Mrpl15 Rat sodium arsenite multiple interactions ISO MRPL15 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MRPL15 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MRPL15 mRNA CTD PMID:39836092 Mrpl15 Rat sodium arsenite decreases expression ISO MRPL15 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of MRPL15 mRNA CTD PMID:38568856 Mrpl15 Rat testosterone decreases expression ISO Mrpl15 (Mus musculus) 6480464 Testosterone results in decreased expression of MRPL15 mRNA CTD PMID:21669218 Mrpl15 Rat thiram decreases expression ISO MRPL15 (Homo sapiens) 6480464 Thiram results in decreased expression of MRPL15 mRNA CTD PMID:38568856 Mrpl15 Rat trichostatin A affects expression ISO MRPL15 (Homo sapiens) 6480464 trichostatin A affects the expression of MRPL15 mRNA CTD PMID:28542535 Mrpl15 Rat triptonide affects expression ISO Mrpl15 (Mus musculus) 6480464 triptonide affects the expression of MRPL15 mRNA CTD PMID:33045310 Mrpl15 Rat valproic acid decreases expression ISO MRPL15 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of MRPL15 mRNA CTD PMID:19101580 Mrpl15 Rat valproic acid increases expression ISO MRPL15 (Homo sapiens) 6480464 Valproic Acid results in increased expression of MRPL15 mRNA CTD PMID:23179753 and PMID:26272509 Mrpl15 Rat valproic acid multiple interactions ISO MRPL15 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MRPL15 mRNA CTD PMID:27188386
(1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) all-trans-retinoic acid (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) buspirone (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) carbon nanotube (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) DDE (ISO) dibenzo[a,l]pyrene (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) diclofenac (ISO) dicrotophos (ISO) dorsomorphin (ISO) ethanol (ISO) ibuprofen (ISO) indometacin (EXP) inulin (ISO) ivermectin (ISO) lead(0) (ISO) maneb (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) paracetamol (ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) propiconazole (ISO) rac-lactic acid (ISO) resveratrol (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) testosterone (ISO) thiram (ISO) trichostatin A (ISO) triptonide (ISO) valproic acid (ISO)
Mrpl15 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 19,527,745 - 19,539,061 (+) NCBI GRCr8 mRatBN7.2 5 14,729,961 - 14,741,276 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 14,729,979 - 14,741,276 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 16,924,207 - 16,935,288 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 18,537,717 - 18,548,790 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 18,258,877 - 18,269,950 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 14,609,656 - 14,620,965 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 14,609,674 - 14,620,965 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 19,392,153 - 19,403,455 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 14,932,623 - 14,943,904 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 14,932,590 - 14,941,120 (+) NCBI Celera 5 14,101,085 - 14,112,172 (+) NCBI Celera Cytogenetic Map 5 q12 NCBI
MRPL15 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 54,135,241 - 54,148,514 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 54,135,241 - 54,148,514 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 55,047,801 - 55,061,074 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 55,210,334 - 55,223,014 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 55,210,333 - 55,223,011 NCBI Celera 8 51,038,346 - 51,051,638 (+) NCBI Celera Cytogenetic Map 8 q11.23 NCBI HuRef 8 50,515,702 - 50,528,983 (+) NCBI HuRef CHM1_1 8 55,099,593 - 55,112,890 (+) NCBI CHM1_1 T2T-CHM13v2.0 8 54,512,543 - 54,525,817 (+) NCBI T2T-CHM13v2.0
Mrpl15 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 4,843,432 - 4,855,949 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 4,843,429 - 4,855,962 (-) Ensembl GRCm39 Ensembl GRCm38 1 4,773,198 - 4,785,750 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 4,773,206 - 4,785,739 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 4,763,279 - 4,775,807 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 4,763,290 - 4,775,791 (-) NCBI MGSCv36 mm8 Celera 1 4,785,037 - 4,797,586 (-) NCBI Celera Cytogenetic Map 1 A1 NCBI cM Map 1 1.79 NCBI
Mrpl15 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955454 13,398,478 - 13,406,794 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955454 13,398,479 - 13,404,353 (+) NCBI ChiLan1.0 ChiLan1.0
MRPL15 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 69,771,654 - 69,784,720 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 45,496,597 - 45,509,681 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 50,560,420 - 50,573,049 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 47,936,446 - 47,948,584 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 47,935,643 - 47,948,584 (+) Ensembl panpan1.1 panPan2
MRPL15 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 29 5,704,572 - 5,711,577 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 29 5,704,585 - 5,711,567 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 29 6,079,400 - 6,086,416 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 29 5,780,690 - 5,787,722 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 29 5,780,733 - 5,788,498 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 29 5,717,373 - 5,724,399 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 29 5,922,950 - 5,929,947 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 29 6,006,201 - 6,013,221 (+) NCBI UU_Cfam_GSD_1.0
Mrpl15
MRPL15 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 77,069,092 - 77,083,723 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 77,069,074 - 77,083,595 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 84,142,552 - 84,149,289 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MRPL15 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 50,201,805 - 50,214,534 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 50,201,829 - 50,216,206 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666039 91,720,535 - 91,733,740 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mrpl15
.
Predicted Target Of
Count of predictions: 113 Count of miRNA genes: 97 Interacting mature miRNAs: 100 Transcripts: ENSRNOT00000011619 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2293666 Bmd38 Bone mineral density QTL 38 4.4 femur size trait (VT:1000369) femoral neck cortical cross-sectional area (CMO:0001702) 5 8948228 53948228 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1300117 Hrtrt8 Heart rate QTL 8 3.49 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 5 3844018 47869213 Rat 7394712 Emca13 Estrogen-induced mammary cancer QTL 13 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 9823266 99753708 Rat 634305 Mamtr1 Mammary tumor resistance QTL 1 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 12789751 113558310 Rat 1331771 Rf35 Renal function QTL 35 4.36965 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 729470 86724018 Rat 2312562 Pur18 Proteinuria QTL 18 2.6 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 5 2138965 32656739 Rat 8662454 Vetf3 Vascular elastic tissue fragility QTL 3 27.4 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 5 2282226 69540447 Rat 61462 Niddm10 Non-insulin dependent diabetes mellitus QTL 10 3.9 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 5 5112159 47171491 Rat 1641903 Alcrsp3 Alcohol response QTL 3 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 12689285 57689285 Rat 1331756 Rf34 Renal function QTL 34 4.16275 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 1 90450412 Rat 631827 Alc4 Alcohol consumption QTL 4 3.5 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 5 8187501 18616199 Rat 2313085 Bss59 Bone structure and strength QTL 59 2.9 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 5 3844018 26141981 Rat
RH131914
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 14,738,850 - 14,739,045 (+) MAPPER mRatBN7.2 Rnor_6.0 5 14,618,540 - 14,618,734 NCBI Rnor6.0 Rnor_5.0 5 19,401,030 - 19,401,224 UniSTS Rnor5.0 RGSC_v3.4 5 14,941,479 - 14,941,673 UniSTS RGSC3.4 Celera 5 14,109,747 - 14,109,941 UniSTS Cytogenetic Map 5 q12 UniSTS
RH140473
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 14,738,061 - 14,738,153 (+) MAPPER mRatBN7.2 Rnor_6.0 5 14,617,751 - 14,617,842 NCBI Rnor6.0 Rnor_5.0 5 19,400,241 - 19,400,332 UniSTS Rnor5.0 RGSC_v3.4 5 14,940,690 - 14,940,781 UniSTS RGSC3.4 Celera 5 14,108,958 - 14,109,049 UniSTS Cytogenetic Map 5 q12 UniSTS
BE118926
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 14,739,999 - 14,740,166 (+) MAPPER mRatBN7.2 Rnor_6.0 5 14,619,689 - 14,619,855 NCBI Rnor6.0 Rnor_5.0 5 19,402,179 - 19,402,345 UniSTS Rnor5.0 RGSC_v3.4 5 14,942,628 - 14,942,794 UniSTS RGSC3.4 Celera 5 14,110,896 - 14,111,062 UniSTS Cytogenetic Map 5 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011619 ⟹ ENSRNOP00000011619
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 14,729,995 - 14,741,276 (+) Ensembl Rnor_6.0 Ensembl 5 14,609,684 - 14,620,965 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000085621 ⟹ ENSRNOP00000074933
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 14,729,979 - 14,738,570 (+) Ensembl Rnor_6.0 Ensembl 5 14,609,674 - 14,618,071 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000115029 ⟹ ENSRNOP00000077151
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 14,729,979 - 14,732,821 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000117082 ⟹ ENSRNOP00000085368
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 14,730,016 - 14,739,065 (+) Ensembl
RefSeq Acc Id:
NM_001106633 ⟹ NP_001100103
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 19,527,746 - 19,539,061 (+) NCBI mRatBN7.2 5 14,729,961 - 14,741,276 (+) NCBI Rnor_6.0 5 14,609,684 - 14,620,965 (+) NCBI Rnor_5.0 5 19,392,153 - 19,403,455 (+) NCBI RGSC_v3.4 5 14,932,623 - 14,943,904 (+) RGD Celera 5 14,101,085 - 14,112,172 (+) RGD
Sequence:
CGCCTTCTGGGCGCCCTTGAAAGGACCGTGGGCCATGGCTGGCATGGCGTTTGGCCGCGGGACCAGTCTGGACCTTCTGCGGTCCTTGCCGAGAGTGAGCCTGGCCAATCTGAAGCCCAGTCTTAACT
hide sequence
RefSeq Acc Id:
NM_001399003 ⟹ NP_001385932
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 19,527,746 - 19,536,164 (+) NCBI mRatBN7.2 5 14,729,961 - 14,738,379 (+) NCBI
RefSeq Acc Id:
NM_001399007 ⟹ NP_001385936
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 19,527,746 - 19,536,164 (+) NCBI mRatBN7.2 5 14,729,961 - 14,738,379 (+) NCBI
RefSeq Acc Id:
NM_001399008 ⟹ NP_001385937
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 19,527,746 - 19,536,164 (+) NCBI mRatBN7.2 5 14,729,961 - 14,738,379 (+) NCBI
RefSeq Acc Id:
NM_001399009 ⟹ NP_001385938
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 19,527,746 - 19,536,164 (+) NCBI mRatBN7.2 5 14,729,961 - 14,738,379 (+) NCBI
RefSeq Acc Id:
NR_174148
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 19,527,746 - 19,536,164 (+) NCBI mRatBN7.2 5 14,729,961 - 14,738,379 (+) NCBI
RefSeq Acc Id:
XM_063287273 ⟹ XP_063143343
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 19,527,745 - 19,531,125 (+) NCBI
RefSeq Acc Id:
NP_001100103 ⟸ NM_001106633
- Peptide Label:
isoform 2
- UniProtKB:
D4A4B1 (UniProtKB/TrEMBL), D4A4A7 (UniProtKB/TrEMBL), A6JFJ4 (UniProtKB/TrEMBL)
- Sequence:
MAGMAFGRGTSLDLLRSLPRVSLANLKPSLNSRKRERRPRDRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYIRIPKYGFNEGHSFRHQYQPLSLRRLQYLIDLGRVDPTQPIDLTQLVNGRGVTI
hide sequence
Ensembl Acc Id:
ENSRNOP00000011619 ⟸ ENSRNOT00000011619
Ensembl Acc Id:
ENSRNOP00000074933 ⟸ ENSRNOT00000085621
Ensembl Acc Id:
ENSRNOP00000085368 ⟸ ENSRNOT00000117082
Ensembl Acc Id:
ENSRNOP00000077151 ⟸ ENSRNOT00000115029
RefSeq Acc Id:
NP_001385932 ⟸ NM_001399003
- Peptide Label:
isoform 1
- UniProtKB:
A0A8I6A254 (UniProtKB/TrEMBL), A6JFJ5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001385937 ⟸ NM_001399008
- Peptide Label:
isoform 4
RefSeq Acc Id:
NP_001385938 ⟸ NM_001399009
- Peptide Label:
isoform 5
- UniProtKB:
A0A0G2K9B4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001385936 ⟸ NM_001399007
- Peptide Label:
isoform 3
RefSeq Acc Id:
XP_063143343 ⟸ XM_063287273
- Peptide Label:
isoform X1
- UniProtKB:
A6JFJ6 (UniProtKB/TrEMBL), A0A8I5Y9C7 (UniProtKB/TrEMBL)
RGD ID: 13693544 Promoter ID: EPDNEW_R4069 Type: initiation region Name: Mrpl15_1 Description: mitochondrial ribosomal protein L15 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 14,609,710 - 14,609,770 EPDNEW
BioCyc Gene G2FUF-42151 BioCyc
Ensembl Genes ENSRNOG00000008566 Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000011619.8 UniProtKB/TrEMBL
ENSRNOT00000085621 ENTREZGENE
ENSRNOT00000085621.2 UniProtKB/TrEMBL
ENSRNOT00000115029 ENTREZGENE
ENSRNOT00000115029.1 UniProtKB/TrEMBL
ENSRNOT00000117082 ENTREZGENE
ENSRNOT00000117082.1 UniProtKB/TrEMBL
Gene3D-CATH 3.100.10.10 UniProtKB/TrEMBL
InterPro L18e/L15P_sf UniProtKB/TrEMBL
Ribosomal_L15 UniProtKB/TrEMBL
Ribosomal_L15_bac-type UniProtKB/TrEMBL
Ribosomal_L18e/L15 UniProtKB/TrEMBL
KEGG Report rno:297799 UniProtKB/TrEMBL
NCBI Gene 297799 ENTREZGENE
PANTHER 39S RIBOSOMAL PROTEIN L15, MITOCHONDRIAL UniProtKB/TrEMBL
Ribosom_L15_bac UniProtKB/TrEMBL
Pfam Ribosomal_L18e UniProtKB/TrEMBL
PhenoGen Mrpl15 PhenoGen
RatGTEx ENSRNOG00000008566 RatGTEx
Superfamily-SCOP Ribosomal_L18e/L15 UniProtKB/TrEMBL
UniProt A0A0G2K9B4 ENTREZGENE, UniProtKB/TrEMBL
A0A8I5Y9C7 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6A254 ENTREZGENE, UniProtKB/TrEMBL
A6JFJ4 ENTREZGENE, UniProtKB/TrEMBL
A6JFJ5 ENTREZGENE, UniProtKB/TrEMBL
A6JFJ6 ENTREZGENE, UniProtKB/TrEMBL
D4A4A7 ENTREZGENE
D4A4B1 ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary D4A4A7 UniProtKB/TrEMBL
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Mrpl15
mitochondrial ribosomal protein L15
Mrpl15_predicted
mitochondrial ribosomal protein L15 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Mrpl15_predicted
mitochondrial ribosomal protein L15 (predicted)
Symbol and Name status set to approved
70820 APPROVED
