Symbol:
Cops4
Name:
COP9 signalosome subunit 4
RGD ID:
1302952
Description:
Predicted to be involved in protein deneddylation. Located in synaptic vesicle. Orthologous to human COPS4 (COP9 signalosome subunit 4); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
COP9 (constitutive photomorphogenic) homolog, subunit 4; COP9 (constitutive photomorphogenic) homolog, subunit 4 (Arabidopsis thaliana); COP9 constitutive photomorphogenic homolog subunit 4; COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis); COP9 signalosome complex subunit 4; JAB1-containing signalosome subunit 4; MGC94896; SGN4; signalosome subunit 4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 9,382,897 - 9,413,216 (-) NCBI GRCr8 mRatBN7.2 14 9,078,579 - 9,108,788 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 9,078,576 - 9,108,887 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 9,050,203 - 9,080,480 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 10,350,063 - 10,380,340 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 9,046,679 - 9,076,956 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 10,718,863 - 10,749,134 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 10,718,844 - 10,749,120 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 10,666,118 - 10,696,489 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 10,329,870 - 10,360,081 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 10,329,870 - 10,360,081 (-) NCBI Celera 14 9,187,509 - 9,217,727 (-) NCBI Celera Cytogenetic Map 14 p22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cops4 Rat 1,2-dimethylhydrazine decreases expression ISO Cops4 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of COPS4 mRNA CTD PMID:22206623 Cops4 Rat 1,2-dimethylhydrazine multiple interactions ISO Cops4 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of COPS4 mRNA CTD PMID:22206623 Cops4 Rat 17alpha-ethynylestradiol increases expression ISO Cops4 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of COPS4 mRNA CTD PMID:17942748 Cops4 Rat 17alpha-ethynylestradiol multiple interactions ISO Cops4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of COPS4 mRNA CTD PMID:17942748 Cops4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Cops4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of COPS4 mRNA and Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to COPS4 promoter] CTD PMID:17942748 and PMID:19654925 Cops4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of COPS4 mRNA CTD PMID:33387578 Cops4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cops4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of COPS4 mRNA CTD PMID:21570461 Cops4 Rat 2,6-dimethoxyphenol multiple interactions ISO COPS4 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Cops4 Rat 2-methylcholine affects expression ISO COPS4 (Homo sapiens) 6480464 beta-methylcholine affects the expression of COPS4 mRNA CTD PMID:21179406 Cops4 Rat 4,4'-sulfonyldiphenol increases expression ISO Cops4 (Mus musculus) 6480464 bisphenol S results in increased expression of COPS4 mRNA CTD PMID:39298647 Cops4 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of COPS4 mRNA CTD PMID:19483382 Cops4 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of COPS4 mRNA CTD PMID:19483382 Cops4 Rat acrolein multiple interactions ISO COPS4 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of COPS4 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of COPS4 mRNA CTD PMID:32699268 Cops4 Rat all-trans-retinoic acid decreases expression ISO COPS4 (Homo sapiens) 6480464 Tretinoin results in decreased expression of COPS4 mRNA CTD PMID:33167477 Cops4 Rat alpha-pinene multiple interactions ISO COPS4 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of COPS4 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of COPS4 mRNA CTD PMID:32699268 Cops4 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of COPS4 mRNA CTD PMID:19483382 Cops4 Rat antirheumatic drug increases expression ISO COPS4 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of COPS4 mRNA CTD PMID:24449571 Cops4 Rat arsenite(3-) multiple interactions ISO COPS4 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to COPS4 protein] and arsenite promotes the reaction [G3BP1 protein binds to COPS4 mRNA] CTD PMID:32406909 Cops4 Rat benzatropine decreases expression ISO COPS4 (Homo sapiens) 6480464 Benztropine results in decreased expression of COPS4 protein CTD PMID:34122009 Cops4 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of COPS4 mRNA CTD PMID:19483382 Cops4 Rat benzo[a]pyrene affects methylation ISO COPS4 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of COPS4 promoter CTD PMID:27901495 Cops4 Rat Benzo[k]fluoranthene decreases expression ISO Cops4 (Mus musculus) 6480464 benzo(k)fluoranthene results in decreased expression of COPS4 mRNA CTD PMID:26377693 Cops4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of COPS4 mRNA CTD PMID:26982218 Cops4 Rat bisphenol A decreases expression ISO COPS4 (Homo sapiens) 6480464 bisphenol A results in decreased expression of COPS4 protein CTD PMID:34186270 Cops4 Rat bisphenol A increases expression ISO COPS4 (Homo sapiens) 6480464 bisphenol A results in increased expression of COPS4 protein CTD PMID:37567409 Cops4 Rat bisphenol A decreases expression ISO Cops4 (Mus musculus) 6480464 bisphenol A results in decreased expression of COPS4 mRNA CTD PMID:33221593 Cops4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of COPS4 mRNA CTD PMID:25181051 Cops4 Rat bisphenol AF increases expression ISO COPS4 (Homo sapiens) 6480464 bisphenol AF results in increased expression of COPS4 protein CTD PMID:34186270 Cops4 Rat Bisphenol B increases expression ISO COPS4 (Homo sapiens) 6480464 bisphenol B results in increased expression of COPS4 protein CTD PMID:34186270 Cops4 Rat bisphenol F increases expression ISO Cops4 (Mus musculus) 6480464 bisphenol F results in increased expression of COPS4 mRNA CTD PMID:38685157 Cops4 Rat bisphenol F increases expression ISO COPS4 (Homo sapiens) 6480464 bisphenol F results in increased expression of COPS4 protein CTD PMID:34186270 Cops4 Rat cadmium atom decreases expression ISO COPS4 (Homo sapiens) 6480464 Cadmium results in decreased expression of COPS4 mRNA CTD PMID:23369406 Cops4 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of COPS4 mRNA CTD PMID:19483382 Cops4 Rat copper(II) sulfate decreases expression ISO COPS4 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of COPS4 mRNA CTD PMID:19549813 Cops4 Rat Dibutyl phosphate affects expression ISO COPS4 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of COPS4 mRNA CTD PMID:37042841 Cops4 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of COPS4 mRNA CTD PMID:21266533 Cops4 Rat dibutyl phthalate decreases expression ISO Cops4 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of COPS4 mRNA CTD PMID:17361019 Cops4 Rat dicrotophos decreases expression ISO COPS4 (Homo sapiens) 6480464 dicrotophos results in decreased expression of COPS4 mRNA CTD PMID:28302478 Cops4 Rat doxorubicin decreases expression ISO COPS4 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of COPS4 mRNA CTD PMID:29803840 Cops4 Rat ethanol affects splicing ISO Cops4 (Mus musculus) 6480464 Ethanol affects the splicing of COPS4 mRNA CTD PMID:30319688 Cops4 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of COPS4 mRNA CTD PMID:24136188 Cops4 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of COPS4 mRNA CTD PMID:24136188 Cops4 Rat folic acid multiple interactions ISO Cops4 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of COPS4 mRNA CTD PMID:22206623 Cops4 Rat furfural multiple interactions ISO COPS4 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Cops4 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of COPS4 mRNA CTD PMID:33387578 Cops4 Rat haloperidol decreases expression ISO COPS4 (Homo sapiens) 6480464 Haloperidol results in decreased expression of COPS4 protein CTD PMID:34122009 Cops4 Rat hyaluronic acid multiple interactions EXP 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of COPS4 protein] CTD PMID:23178681 Cops4 Rat hydralazine multiple interactions ISO COPS4 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of COPS4 mRNA CTD PMID:17183730 Cops4 Rat hydrogen peroxide multiple interactions EXP 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of COPS4 protein] CTD PMID:23178681 Cops4 Rat hydrogen peroxide decreases expression EXP 6480464 Hydrogen Peroxide results in decreased expression of COPS4 protein CTD PMID:23178681 Cops4 Rat ivermectin decreases expression ISO COPS4 (Homo sapiens) 6480464 Ivermectin results in decreased expression of COPS4 protein CTD PMID:32959892 Cops4 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of COPS4 mRNA CTD PMID:19483382 Cops4 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of COPS4 mRNA CTD PMID:24136188 Cops4 Rat mono(2-ethylhexyl) phthalate decreases expression ISO COPS4 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of COPS4 mRNA CTD PMID:38685446 Cops4 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of COPS4 mRNA CTD PMID:24136188 Cops4 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of COPS4 mRNA CTD PMID:19483382 Cops4 Rat ozone multiple interactions ISO COPS4 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of COPS4 mRNA more ... CTD PMID:32699268 and PMID:35430440 Cops4 Rat paracetamol affects expression ISO Cops4 (Mus musculus) 6480464 Acetaminophen affects the expression of COPS4 mRNA CTD PMID:17562736 Cops4 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of COPS4 mRNA CTD PMID:33387578 Cops4 Rat perfluorododecanoic acid increases expression EXP 6480464 perfluorododecanoic acid results in increased expression of COPS4 protein CTD PMID:26168851 Cops4 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of COPS4 mRNA CTD PMID:19483382 Cops4 Rat quercetin decreases expression ISO COPS4 (Homo sapiens) 6480464 Quercetin results in decreased expression of COPS4 mRNA CTD PMID:21632981 Cops4 Rat SB 431542 multiple interactions ISO COPS4 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of COPS4 protein CTD PMID:37664457 Cops4 Rat sodium arsenite increases expression ISO COPS4 (Homo sapiens) 6480464 sodium arsenite results in increased expression of COPS4 mRNA CTD PMID:17879257 Cops4 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of COPS4 protein CTD PMID:29459688 Cops4 Rat sodium chloride multiple interactions ISO COPS4 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of COPS4 protein more ... CTD PMID:38598786 Cops4 Rat thapsigargin decreases expression ISO COPS4 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of COPS4 protein CTD PMID:21692457 Cops4 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of COPS4 mRNA CTD PMID:19483382 Cops4 Rat titanium dioxide decreases methylation ISO Cops4 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of COPS4 gene CTD PMID:35295148 Cops4 Rat triphenyl phosphate affects expression ISO COPS4 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of COPS4 mRNA CTD PMID:37042841 Cops4 Rat triptonide affects expression ISO Cops4 (Mus musculus) 6480464 triptonide affects the expression of COPS4 mRNA CTD PMID:33045310 Cops4 Rat valproic acid multiple interactions ISO COPS4 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of COPS4 mRNA CTD PMID:17183730 Cops4 Rat valproic acid affects expression ISO Cops4 (Mus musculus) 6480464 Valproic Acid affects the expression of COPS4 mRNA CTD PMID:17292431
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2-methylcholine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) acrolein (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) amiodarone (EXP) antirheumatic drug (ISO) arsenite(3-) (ISO) benzatropine (ISO) benzbromarone (EXP) benzo[a]pyrene (ISO) Benzo[k]fluoranthene (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium atom (ISO) clofibrate (EXP) copper(II) sulfate (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dicrotophos (ISO) doxorubicin (ISO) ethanol (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) furfural (ISO) gentamycin (EXP) haloperidol (ISO) hyaluronic acid (EXP) hydralazine (ISO) hydrogen peroxide (EXP) ivermectin (ISO) L-ethionine (EXP) leflunomide (EXP) mono(2-ethylhexyl) phthalate (ISO) nefazodone (EXP) omeprazole (EXP) ozone (ISO) paracetamol (EXP,ISO) perfluorododecanoic acid (EXP) pirinixic acid (EXP) quercetin (ISO) SB 431542 (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) thapsigargin (ISO) thioacetamide (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO)
Cops4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 9,382,897 - 9,413,216 (-) NCBI GRCr8 mRatBN7.2 14 9,078,579 - 9,108,788 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 9,078,576 - 9,108,887 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 9,050,203 - 9,080,480 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 10,350,063 - 10,380,340 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 9,046,679 - 9,076,956 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 10,718,863 - 10,749,134 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 10,718,844 - 10,749,120 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 10,666,118 - 10,696,489 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 10,329,870 - 10,360,081 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 10,329,870 - 10,360,081 (-) NCBI Celera 14 9,187,509 - 9,217,727 (-) NCBI Celera Cytogenetic Map 14 p22 NCBI
COPS4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 83,035,183 - 83,075,818 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 83,034,447 - 83,075,818 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 83,956,336 - 83,996,971 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 84,175,263 - 84,215,995 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 84,313,417 - 84,354,149 NCBI Celera 4 81,246,788 - 81,287,480 (+) NCBI Celera Cytogenetic Map 4 q21.22 NCBI HuRef 4 79,696,991 - 79,738,024 (+) NCBI HuRef CHM1_1 4 83,932,721 - 83,973,422 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 86,364,418 - 86,405,022 (+) NCBI T2T-CHM13v2.0
Cops4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 100,666,223 - 100,695,668 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 100,666,175 - 100,695,669 (+) Ensembl GRCm39 Ensembl GRCm38 5 100,518,295 - 100,547,802 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 100,518,309 - 100,547,803 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 100,947,328 - 100,976,821 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 100,758,758 - 100,788,078 (+) NCBI MGSCv36 mm8 Celera 5 97,844,415 - 97,873,735 (+) NCBI Celera Cytogenetic Map 5 E4 NCBI cM Map 5 48.49 NCBI
Cops4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955474 6,539,313 - 6,582,551 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955474 6,540,022 - 6,581,881 (-) NCBI ChiLan1.0 ChiLan1.0
COPS4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 46,997,314 - 47,039,384 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 47,186,479 - 47,228,019 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 41,129,731 - 41,171,150 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 46,980,585 - 47,022,117 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 46,980,585 - 47,022,117 (-) Ensembl panpan1.1 panPan2
COPS4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 32 6,957,189 - 6,997,573 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 32 6,957,390 - 6,997,180 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 32 34,887,844 - 34,928,232 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 32 6,978,409 - 7,018,953 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 32 6,873,174 - 7,018,945 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 32 7,049,431 - 7,089,809 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 32 6,917,989 - 6,958,354 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 32 33,003,236 - 33,048,104 (-) NCBI UU_Cfam_GSD_1.0
Cops4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405285 5,349,474 - 5,383,444 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936738 1,511,301 - 1,545,439 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936738 1,511,301 - 1,545,274 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
COPS4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 135,280,506 - 135,314,460 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 135,280,475 - 135,314,393 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 144,575,339 - 144,609,232 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
COPS4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 31,426,600 - 31,466,590 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 31,427,121 - 31,466,721 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 10,005,130 - 10,045,121 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cops4
.
Predicted Target Of
Count of predictions: 204 Count of miRNA genes: 139 Interacting mature miRNAs: 160 Transcripts: ENSRNOT00000003046 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300114 Srn2 Serum renin concentration QTL 2 3.27 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 14 3813074 21217635 Rat 2293089 Iddm31 Insulin dependent diabetes mellitus QTL 31 4.7 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 14 3813074 18274691 Rat 1581500 Renag1 Renal agenesis QTL 1 kidney development trait (VT:0000527) percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940) 14 8170668 68298175 Rat 731183 Pia20 Pristane induced arthritis QTL 20 3.55 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 9088978 39057237 Rat 1331740 Bw26 Body weight QTL 26 3.028 body mass (VT:0001259) body weight (CMO:0000012) 14 3813074 30767156 Rat 619619 Rf4 Renal disease susceptibility QTL 4 4.1 0.002 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 14 1 32754612 Rat 71115 Niddm15 Non-insulin dependent diabetes mellitus QTL 15 4.8 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 14 1217606 11030812 Rat 1358296 Ael3 Aortic elastin QTL 3 3.7 0.00051 aorta elastin amount (VT:0003905) aortic elastin 14 8267090 53267090 Rat 70195 Mcs8 Mammary carcinoma susceptibility QTL 8 4.28 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 14 3813074 24531477 Rat 2300183 Bmd60 Bone mineral density QTL 60 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 14 1 26541967 Rat 724541 Niddm53 Non-insulin dependent diabetes mellitus QTL 53 0.001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 3813074 9088978 Rat 634352 Apr6 Acute phase response QTL 6 3.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 14 1 41131407 Rat 2300159 Bmd61 Bone mineral density QTL 61 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 14 1 26541967 Rat 70204 Niddm20 Non-insulin dependent diabetes mellitus QTL 20 5.1 0.000008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 1217606 16960180 Rat 2302045 Pia39 Pristane induced arthritis QTL 39 4.9 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G2a level (CMO:0002116) 14 8267090 53267090 Rat
D14Rat3
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 14 9,393,127 - 9,393,298 (+) Marker Load Pipeline mRatBN7.2 14 9,088,809 - 9,088,978 (+) MAPPER mRatBN7.2 mRatBN7.2 1 242,824,825 - 242,824,866 (+) MAPPER mRatBN7.2 mRatBN7.2 1 242,824,821 - 242,824,860 (+) MAPPER mRatBN7.2 Rnor_6.0 14 10,729,098 - 10,729,268 NCBI Rnor6.0 Rnor_5.0 14 10,676,485 - 10,676,655 UniSTS Rnor5.0 RGSC_v3.4 14 10,340,102 - 10,340,272 UniSTS RGSC3.4 RGSC_v3.4 14 10,339,971 - 10,340,377 RGD RGSC3.4 RGSC_v3.1 14 10,340,102 - 10,340,272 RGD Celera 14 9,197,754 - 9,197,924 UniSTS RH 3.4 Map 14 152.08 RGD RH 3.4 Map 14 152.08 UniSTS RH 2.0 Map 14 162.0 RGD SHRSP x BN Map 14 4.62 RGD Cytogenetic Map 14 p22 UniSTS
RH143839
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 9,108,022 - 9,108,175 (+) MAPPER mRatBN7.2 Rnor_6.0 14 10,748,312 - 10,748,464 NCBI Rnor6.0 Rnor_5.0 14 10,695,699 - 10,695,851 UniSTS Rnor5.0 RGSC_v3.4 14 10,359,316 - 10,359,468 UniSTS RGSC3.4 Celera 14 9,216,962 - 9,217,114 UniSTS RH 3.4 Map 14 131.09 UniSTS Cytogenetic Map 14 p22 UniSTS
BI274688
Rat Assembly Chr Position (strand) Source JBrowse Rnor_6.0 14 7,518,601 - 7,518,772 NCBI Rnor6.0 Rnor_6.0 14 10,718,992 - 10,719,163 NCBI Rnor6.0 Rnor_5.0 14 7,496,400 - 7,496,571 UniSTS Rnor5.0 Rnor_5.0 14 10,666,247 - 10,666,418 UniSTS Rnor5.0 RGSC_v3.4 14 10,329,995 - 10,330,166 UniSTS RGSC3.4 Celera 14 9,187,634 - 9,187,805 UniSTS RH 3.4 Map 14 130.59 UniSTS Cytogenetic Map 14 p22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000003046 ⟹ ENSRNOP00000003046
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 9,078,576 - 9,108,887 (-) Ensembl Rnor_6.0 Ensembl 14 10,718,844 - 10,749,120 (-) Ensembl
RefSeq Acc Id:
NM_001004275 ⟹ NP_001004275
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 9,382,897 - 9,413,107 (-) NCBI mRatBN7.2 14 9,078,579 - 9,108,788 (-) NCBI Rnor_6.0 14 10,718,867 - 10,749,077 (-) NCBI Rnor_5.0 14 10,666,118 - 10,696,489 (-) NCBI RGSC_v3.4 14 10,329,870 - 10,360,081 (-) RGD Celera 14 9,187,509 - 9,217,727 (-) RGD
Sequence:
GCGAGAGGTCCCGCAGCCGTGGCTGAGCTGGAAGAAAGATGGCGGCTGCCGTGCGACAGGATTTGGCCCAGCTCATGAATTCAAGCGGCTCTCACAAAGATCTGGCGGGCAAATATCGTCAGATTCTG
hide sequence
RefSeq Acc Id:
XM_063273328 ⟹ XP_063129398
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 9,382,897 - 9,413,175 (-) NCBI
RefSeq Acc Id:
XM_063273329 ⟹ XP_063129399
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 9,382,897 - 9,413,216 (-) NCBI
RefSeq Acc Id:
XM_063273330 ⟹ XP_063129400
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 9,382,897 - 9,413,144 (-) NCBI
RefSeq Acc Id:
NP_001004275 ⟸ NM_001004275
- UniProtKB:
Q68FS2 (UniProtKB/Swiss-Prot), A6K5Z4 (UniProtKB/TrEMBL), A0A8L2Q0P3 (UniProtKB/TrEMBL)
- Sequence:
MAAAVRQDLAQLMNSSGSHKDLAGKYRQILEKAIQLSGTEQLEALKAFVEAMVNENVSLVISRQLLTDFCTHLPNLPDSTAKEVYHFTLEKVQPRVISFEEQVASIRQRLASIYEKEEDWRNAAQVLV
hide sequence
Ensembl Acc Id:
ENSRNOP00000003046 ⟸ ENSRNOT00000003046
RefSeq Acc Id:
XP_063129399 ⟸ XM_063273329
- Peptide Label:
isoform X2
- UniProtKB:
A0A8L2Q0P3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129398 ⟸ XM_063273328
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2Q0P3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129400 ⟸ XM_063273330
- Peptide Label:
isoform X3
RGD ID: 13699195 Promoter ID: EPDNEW_R9719 Type: initiation region Name: Cops4_1 Description: COP9 signalosome subunit 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 10,749,048 - 10,749,108 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-03-20
Cops4
COP9 signalosome subunit 4
Cops4
COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-10-23
Cops4
COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis)
Cops4
COP9 (constitutive photomorphogenic) homolog, subunit 4 (Arabidopsis thaliana)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Cops4
COP9 (constitutive photomorphogenic) homolog, subunit 4 (Arabidopsis thaliana)
COP9 signalosome subunit 4
Name updated
1299863 APPROVED
2005-02-14
Cops4
COP9 signalosome subunit 4
Symbol and Name status set to provisional
70820 PROVISIONAL
