Advanced Search (OLGA)

Gene: Eid2b (EP300 interacting inhibitor of differentiation 2B) Rattus norvegicus

Analyze

Symbol:

Eid2b

Name:

EP300 interacting inhibitor of differentiation 2B

RGD ID:

9381183

Description:

Predicted to enable identical protein binding activity and transcription corepressor activity. Predicted to be involved in negative regulation of DNA-templated transcription and negative regulation of myoblast differentiation. Predicted to be located in nucleus. Predicted to be active in nucleoplasm; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; cobalt dichloride.

Type:

protein-coding (Ensembl: lncRNA)

RefSeq Status:

VALIDATED

Previously known as:

EP300-interacting inhibitor of differentiation 2B; RGD1560818; RGD9381183

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	92,673,119 - 92,674,899 (+)	NCBI		GRCr8
mRatBN7.2	1	83,545,530 - 83,547,338 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	83,545,563 - 83,546,734 (-)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	1	85,508,397 - 85,510,131 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	85,509,662 - 85,510,114 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Celera	1	77,944,621 - 77,946,356 (+)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Carpenter Syndrome 2 (ISO)

congenital hypoplastic anemia (ISO)

craniosynostosis 1 (ISO)

Diamond-Blackfan anemia (ISO)

maple syrup urine disease (ISO)

maturity-onset diabetes of the young type 1 (ISO)

type 2 diabetes mellitus (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

acrylamide (ISO)

aflatoxin B1 (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

cisplatin (ISO)

cobalt dichloride (EXP)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

dorsomorphin (ISO)

ethyl methanesulfonate (ISO)

folic acid (ISO)

formaldehyde (ISO)

lead(0) (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

ozone (ISO)

p-chloromercuribenzoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylmercury acetate (ISO)

quercetin (ISO)

SB 431542 (ISO)

sunitinib (ISO)

temozolomide (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

trovafloxacin (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of DNA-templated transcription (ISO)

negative regulation of myoblast differentiation (ISO)

Cellular Component

nucleus (ISO)

Molecular Function

identical protein binding (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Eid2b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	92,673,119 - 92,674,899 (+)	NCBI		GRCr8
mRatBN7.2	1	83,545,530 - 83,547,338 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	83,545,563 - 83,546,734 (-)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	1	85,508,397 - 85,510,131 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	85,509,662 - 85,510,114 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Celera	1	77,944,621 - 77,946,356 (+)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

EID2B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	39,530,987 - 39,532,852 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	39,530,987 - 39,532,852 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	40,021,627 - 40,023,492 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	44,713,470 - 44,715,334 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	19	36,823,341 - 36,825,205 (-)	NCBI		Celera
Cytogenetic Map	19	q13.2	NCBI
HuRef	19	36,467,983 - 36,469,847 (-)	NCBI		HuRef
CHM1_1	19	40,022,235 - 40,024,098 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	42,335,245 - 42,337,110 (-)	NCBI		T2T-CHM13v2.0

Eid2b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	27,977,152 - 27,978,916 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	27,977,164 - 27,978,914 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	28,277,706 - 28,280,129 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	28,277,739 - 28,279,489 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	29,062,725 - 29,065,148 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	27,986,400 - 27,987,754 (+)	NCBI		MGSCv36	mm8
Celera	7	22,839,330 - 22,841,753 (+)	NCBI		Celera
Cytogenetic Map	7	A3	NCBI
cM Map	7	16.67	NCBI

Eid2b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955468	48,573 - 50,029 (+)	NCBI	ChiLan1.0	ChiLan1.0

EID2B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	45,823,975 - 45,828,655 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	47,694,559 - 47,699,595 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	36,629,480 - 36,631,665 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	45,177,751 - 45,179,081 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	45,178,537 - 45,179,022 (-)	Ensembl	panpan1.1		panPan2

Eid2b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	13,923,971 - 13,926,929 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936661	2,354,497 - 2,354,966 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936661	2,352,726 - 2,354,968 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EID2B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	34,131,492 - 34,133,542 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	34,132,832 - 34,133,317 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	12,154,801 - 12,156,692 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Eid2b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624794	12,826,376 - 12,827,772 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Eid2b
14 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	12
Count of miRNA genes:	11
Interacting mature miRNAs:	12
Transcripts:	ENSRNOT00000074665
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	72197680	90508767	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	82174743	118944897	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889494	Scort2	Serum corticosterone level QTL 2	4.2		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	80592172	125592172	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	78430754	91209302	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001329142	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000074665 ⟹ ENSRNOP00000067743

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	83,545,563 - 83,546,734 (-)	Ensembl
Rnor_6.0 Ensembl	1	85,509,662 - 85,510,114 (-)	Ensembl

RefSeq Acc Id:

NM_001329142 ⟹ NP_001316071

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	92,673,119 - 92,674,899 (+)	NCBI
mRatBN7.2	1	83,545,558 - 83,547,338 (+)	NCBI
Rnor_6.0	1	85,508,397 - 85,510,131 (-)	NCBI
Celera	1	77,944,621 - 77,946,356 (+)	NCBI

Sequence:

show sequence

GGACTCAACGGTCCGCAATGTCCGAGCTGCCCGGAGAAAGCAGGATCCCGGACCTGTGCCCTAT
GAACGGCGTCGGCAACGTCCTGCAGGCGGGAGTGGGCGGAGGCAATCGGGTCCCCGAAGCCCTG
GAAGGCCCGCTGGCCAGAGCCGCCCGGACCATGGCGCGGGCTCCGGGCCTGGCTCCCGGGCCGT
TCCCCGGCATGGCGGGCCTGATGGCCATACCGCACGTCCCCCCGCCGCTCCGCCTTCTAGAGCT
GCACGAGCAGCGGATGTTCGAACACTACCTGCACACCAACCCCCTGATCCCCACCAGGCTGCTC
CGCGAAATCGAGGAGCGTCGCCGGCTGTTCGTGGAGGGCTGCAGGGCCAGGGAGGCGGCCTTCG
ACGCCGACCCCCCGCAGTTGGACTCGGAGGCCCGCGCCTTCACGCTGGCGCTCACGGCCTCCGA
CGCCCACGGCCCCACCGCAGACTGAGGGTTGGCCTTTGCCTATAATCTCAGTCCTCAGGAGGGA
GGAAGCCTGAGGATCCAGAGTTCAAGATCATCCTCCGCTATGTAGCGAGTTGGAGGCCAGCCTG
GGCTACAGGAGACTCTGTCTTTTAAAAATAATAAAACAAAAAAGATTGGTGGCCAGGAAGTCAG
GTGACTCTTAGGATCAAGGGCAAAGGCAGATGTCCAGGCAAATGTCATGAGGTGGGAAATCCAA
GCCAGAATACAGCCAAGGGCTGGGTGGAATGAAGCAGGCCCAGAAAGAGATGGACACTCGAGGC
TTGAGGCTGACAAGCAAAGAGGACTCTTCTGACTTCCACCTTGTGACTGTCAGCAATCTTTCCC
TCCCCTGCTTTCGTTGAAAATCATGTTTTTTTTTTCCACAGGGAAGGACGATGGTTTTGCAAAG
ATGAAGTCTTAAGAATTACCAATGAAAAGACGGAGATGCGGAAAGAAACCAGGGAAATGTGATT
GTTAGATTCAGTTGCTTCTGGGTTTTATTGGAGTAAGAAGAAGGCTGTTGAAACAACGTGGACA
TTTCAGAATTGTGGGGTCACCTCATTGTCAGCTGACAAGCTCAATGTATCGTTAATTCTTGTGT
TTGGTGTTCTGTAGATAAGTTGTAAATATTCAGATAGGGAAAATCTATGTGCGTTGTGAGATGA
ATATTTTTCAAGACCTTGTGTAATTGTATCCATGTGGAAAAAGATGAGTTAGTATTTAAAGGAT
ACGGACACAAGACTCAAAATTAGCAAAAGATACTAAGGGAAGGTTAAACTTTTCTGCCAAATTG
AAAACAGGTGTCCATACAGATTTGGGTTAGGGTGGGAAGTTGTTTTCTGTAGGGTCTTCAAAAC
CATTTTATAAGGCGTATATGAATTGGTACCAATCCAGTTATCCCCCAATCCTGGGTGCTGAAGA
TGGATCCCAGGCCTTGCCCTGCTCCCAGTCCTCCTGAATCAAGGTAAGATAGGATCATGGCCCA
GTGGTCAAAAATGTCCGCTGCTCAGCCTTGTTACTGAGTTTGATCCCGGGACCCACGAGGTGGA
AGAAGAAACCACACCCATGTCCTCCGAGCAGCACGCACACGTGCACACACTCATGCAATGTAAA
GAAATCTACATAGTACATATATCGGCATCTTGGGTTCTTATGTTACAATGGAAGTGATCCTCCA
TCGTTTTGTCCTTAATGACTACTATCGGAGTCTGTATCTTAACTTATCTAATGAACTAGTTGTC
TTCTGGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001316071	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001316071 ⟸ NM_001329142
- UniProtKB:	M0RDN8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSELPGESRIPDLCPMNGVGNVLQAGVGGGNRVPEALEGPLARAARTMARAPGLAPGPFPGMAG LMAIPHVPPPLRLLELHEQRMFEHYLHTNPLIPTRLLREIEERRRLFVEGCRAREAAFDADPPQ LDSEARAFTLALTASDAHGPTAD hide sequence

Ensembl Acc Id:

ENSRNOP00000067743 ⟸ ENSRNOT00000074665

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-M0RDN8-F1-model_v2	AlphaFold	M0RDN8	1-151	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689883

Promoter ID:

EPDNEW_R402

Type:

single initiation site

Name:

Eid2b_1

Description:

EP300 interacting inhibitor of differentiation 2B

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	85,510,165 - 85,510,225	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
Ensembl Genes	ENSRNOG00000045545	Ensembl
NCBI Gene	Eid2b	ENTREZGENE
PhenoGen	Eid2b	PhenoGen
RatGTEx	ENSRNOG00000045545	RatGTEx
UniProt	M0RDN8	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2010-04-23	Eid2b	EP300 interacting inhibitor of differentiation 2B	RGD1560818	similar to hypothetical protein FLJ38944	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1560818	similar to hypothetical protein FLJ38944	RGD1560818_predicted	similar to hypothetical protein FLJ38944 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1560818_predicted	similar to hypothetical protein FLJ38944 (predicted)	LOC499112	similar to hypothetical protein FLJ38944	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC499112	similar to hypothetical protein FLJ38944			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar