Symbol:
Pnliprp1
Name:
pancreatic lipase related protein 1
RGD ID:
9002638
Description:
ENCODES a protein that exhibits calcium ion binding (ortholog); lipase activity (ortholog); INVOLVED IN pancreas development (ortholog); response to glucocorticoid (ortholog); response to peptide hormone (ortholog); ASSOCIATED WITH prostate cancer (ortholog); syndromic microphthalmia 11 (ortholog); FOUND IN extracellular space (ortholog)
Type:
protein-coding
RefSeq Status:
MODEL
Previously known as:
inactive pancreatic lipase-related protein 1; pancreatic lipase-related protein 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
ChiLan1.0 - Chinchilla ChiLan1.0 Assembly
Position:
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955431 21,391,166 - 21,406,617 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955431 21,391,166 - 21,406,617 (+) NCBI ChiLan1.0 ChiLan1.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Pnliprp1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955431 21,391,166 - 21,406,617 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955431 21,391,166 - 21,406,617 (+) NCBI ChiLan1.0 ChiLan1.0
PNLIPRP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 116,590,959 - 116,609,175 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 116,590,385 - 116,609,175 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 118,350,471 - 118,368,687 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 118,340,480 - 118,358,676 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 118,340,479 - 118,358,676 NCBI Celera 10 112,079,787 - 112,097,984 (+) NCBI Celera Cytogenetic Map 10 q25.3 NCBI HuRef 10 111,977,755 - 111,995,968 (+) NCBI HuRef CHM1_1 10 118,633,621 - 118,651,818 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 117,485,016 - 117,503,281 (+) NCBI T2T-CHM13v2.0
Pnliprp1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 58,717,319 - 58,732,601 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 58,717,319 - 58,732,601 (+) Ensembl GRCm39 Ensembl GRCm38 19 58,728,887 - 58,744,169 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 58,728,887 - 58,744,169 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 58,803,377 - 58,818,659 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 58,782,137 - 58,797,419 (+) NCBI MGSCv36 mm8 Celera 19 60,925,754 - 60,941,038 (+) NCBI Celera Cytogenetic Map 19 D2 NCBI cM Map 19 54.49 NCBI
Pnliprp1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 267,854,027 - 267,869,654 (+) NCBI GRCr8 mRatBN7.2 1 257,867,885 - 257,883,514 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 257,867,885 - 257,883,514 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 266,072,078 - 266,087,671 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 272,778,094 - 272,793,685 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 265,420,355 - 265,436,179 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 279,867,034 - 279,882,663 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 279,867,034 - 279,882,663 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 287,228,054 - 287,243,683 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 265,237,786 - 265,253,415 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 265,448,830 - 265,464,460 (+) NCBI Celera 1 253,523,704 - 253,539,212 (+) NCBI Celera Cytogenetic Map 1 q55 NCBI
PNLIPRP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 27,167,754 - 27,183,104 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 27,139,230 - 27,212,178 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 27,318,314 - 27,333,662 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 27,704,442 - 27,719,793 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 27,675,917 - 27,749,003 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 27,258,945 - 27,274,286 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 27,278,370 - 27,293,714 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 27,467,324 - 27,482,673 (+) NCBI UU_Cfam_GSD_1.0
Pnliprp1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 18,998,121 - 19,012,865 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936486 6,548,603 - 6,563,148 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936486 6,548,481 - 6,563,144 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PNLIPRP1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 126,797,074 - 126,812,152 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 126,796,943 - 126,812,152 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 138,093,021 - 138,108,274 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PNLIPRP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 109,397,970 - 109,417,422 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 109,399,227 - 109,417,351 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 70,633,565 - 70,671,594 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pnliprp1
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSCLAT00000004811 ⟹ ENSCLAP00000004723
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 Ensembl NW_004955431 21,391,166 - 21,406,617 (+) Ensembl
RefSeq Acc Id:
XM_005387852 ⟹ XP_005387909
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 NW_004955431 21,391,166 - 21,406,617 (+) NCBI
Sequence:
ATGCTGCTCTTCTGGACAACCACACTTCTACTGCTGGGAGCAGCCCGAGGGAAAGAAGTTTGCTATGGTGACCTTGGGTGCTTTTCTGACGCTGAGCCCTGGGCTGGGACTGCAGTCAGGCCACTGAA
hide sequence
RefSeq Acc Id:
XP_005387909 ⟸ XM_005387852
- UniProtKB:
A0A8C2URE1 (UniProtKB/TrEMBL)
- Sequence:
MLLFWTTTLLLLGAARGKEVCYGDLGCFSDAEPWAGTAVRPLKILPWTPEKIDTHFLLYTNENPDNFQILHLSDPSTIEASNFQTTRKTRFIIHGFIDKGDESWVTDMCKAMFEVEEVNCVCVDWRKG
hide sequence
Ensembl Acc Id:
ENSCLAP00000004723 ⟸ ENSCLAT00000004811
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-08-03
Pnliprp1
pancreatic lipase related protein 1
pancreatic lipase-related protein 1
Symbol and/or name change
5135510 APPROVED
