Symbol:
Purb
Name:
purine rich element binding protein B
RGD ID:
8836794
Description:
ENCODES a protein that exhibits DNA-binding transcription factor activity (ortholog); DNA-binding transcription factor binding (ortholog); DNA-binding transcription repressor activity, RNA polymerase II-specific (ortholog); INVOLVED IN negative regulation of DNA-templated transcription (ortholog); negative regulation of transcription by RNA polymerase II (ortholog); positive regulation of transcription by RNA polymerase II (ortholog); ASSOCIATED WITH pleomorphic xanthoastrocytoma (ortholog); FOUND IN nucleoplasm (ortholog); nucleus (ortholog)
Type:
protein-coding
RefSeq Status:
MODEL
Previously known as:
purine-rich element binding protein B; transcriptional activator protein Pur-beta
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
ChiLan1.0 - Chinchilla ChiLan1.0 Assembly
NCBI Annotation Information:
Annotation category: partial on reference assembly
Position:
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955456 7,322,973 - 7,323,529 (+) NCBI ChiLan1.0 ChiLan1.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Purb Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955456 7,322,973 - 7,323,529 (+) NCBI ChiLan1.0 ChiLan1.0
PURB Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 44,876,299 - 44,885,530 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 44,876,299 - 44,885,530 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 44,915,898 - 44,925,129 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 44,882,417 - 44,891,485 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 44,689,133 - 44,698,200 NCBI Celera 7 45,014,669 - 45,023,741 (-) NCBI Celera Cytogenetic Map 7 p13 NCBI HuRef 7 44,801,230 - 44,810,302 (-) NCBI HuRef CHM1_1 7 44,920,237 - 44,929,309 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 45,036,709 - 45,045,943 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 44,955,325 - 44,964,397 (-) NCBI
Purb Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 6,417,599 - 6,426,076 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 6,417,599 - 6,425,917 (-) Ensembl GRCm39 Ensembl GRCm38 11 6,467,599 - 6,476,076 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 6,467,599 - 6,475,917 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 6,374,776 - 6,375,920 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 6,374,776 - 6,375,920 (-) NCBI MGSCv36 mm8 Celera 11 6,960,150 - 6,961,293 (-) NCBI Celera Cytogenetic Map 11 A1 NCBI cM Map 11 4.16 NCBI
Purb Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 85,556,296 - 85,558,779 (-) NCBI GRCr8 mRatBN7.2 14 81,342,374 - 81,344,857 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 81,336,448 - 81,351,432 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 85,743,668 - 85,746,151 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 86,983,466 - 86,985,949 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 83,433,062 - 83,435,545 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 86,736,876 - 86,739,335 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 86,736,878 - 86,739,335 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 80,371,417 - 80,373,876 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 87,230,346 - 87,232,805 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 14 80,223,695 - 80,226,154 (-) NCBI Celera Cytogenetic Map 14 q21 NCBI
PURB Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 49,789,512 - 49,802,328 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 98,114,250 - 98,127,055 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 45,590,183 - 45,600,089 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 45,659,121 - 45,673,991 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 45,667,233 - 45,668,159 (-) Ensembl panpan1.1 panPan2
PURB Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Dog10K_Boxer_Tasha 16 2,512,329 - 2,520,763 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 16 14,340,299 - 14,348,729 (+) NCBI ROS_Cfam_1.0 UNSW_CanFamBas_1.0 16 13,973,590 - 13,982,018 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 16 13,952,878 - 13,961,316 (+) NCBI UU_Cfam_GSD_1.0
Purb
PURB Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 18 50,510,182 - 50,511,108 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 18 50,510,010 - 50,518,965 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 18 55,333,599 - 55,342,149 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PURB Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 13,796,087 - 13,805,162 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 13,796,118 - 13,797,056 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666062 8,731,839 - 8,741,238 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Purb
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
RefSeq Acc Id:
XM_013520514 ⟹ XP_013375968
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 NW_004955456 7,322,973 - 7,323,529 (+) NCBI
Sequence:
GGCCTGCAGAGCGGCCAGACCATCGCGCTGCCGGCGCAGGGCCTCATCGAGTTCCGCGACGCGCTGGCCAAGCTCATCGACGACTACGGGGCCGAGGACGACGAGCTGTCGGGCGGCCCGGGGGGCGG
hide sequence
RefSeq Acc Id:
XP_013375968 ⟸ XM_013520514
- Sequence:
GLQSGQTIALPAQGLIEFRDALAKLIDDYGAEDDELSGGPGGGGPGAGLYGELPEGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYADEMKEIQERQRDKLYERR
hide sequence
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-08-03
Purb
purine rich element binding protein B
purine-rich element binding protein B
Symbol and/or name change
5135510 APPROVED
2015-08-25
Purb
purine-rich element binding protein B
LOC102008380
uncharacterized LOC102008380
Symbol and/or name change
5135510 APPROVED
