Symbol:
Sacm1l
Name:
SAC1 like phosphatidylinositide phosphatase
RGD ID:
8817217
Description:
ENCODES a protein that exhibits phosphatase activity (ortholog); phosphatidylinositol-3,5-bisphosphate phosphatase activity (ortholog); phosphatidylinositol-3-phosphate phosphatase activity (ortholog); INVOLVED IN exocytic insertion of neurotransmitter receptor to postsynaptic membrane (ortholog); neurotransmitter receptor transport to postsynaptic membrane (ortholog); phosphatidylinositol dephosphorylation (ortholog); ASSOCIATED WITH Progressive Microcephaly with Seizures and Cerebral and Cerebellar Atrophy (ortholog); FOUND IN AMPA glutamate receptor complex (ortholog); endoplasmic reticulum membrane (ortholog); endoplasmic reticulum-plasma membrane contact site (ortholog)
Type:
protein-coding
RefSeq Status:
MODEL
Previously known as:
phosphatidylinositide phosphatase SAC1; SAC1 suppressor of actin mutations 1 like; SAC1 suppressor of actin mutations 1 like (yeast); SAC1 suppressor of actin mutations 1-like (yeast)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
ChiLan1.0 - Chinchilla ChiLan1.0 Assembly
Position:
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955420 26,229,840 - 26,280,516 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955420 26,231,597 - 26,280,516 (-) NCBI ChiLan1.0 ChiLan1.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Sacm1l Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955420 26,229,840 - 26,280,516 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955420 26,231,597 - 26,280,516 (-) NCBI ChiLan1.0 ChiLan1.0
SACM1L Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 45,689,396 - 45,745,409 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 45,689,056 - 45,745,412 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 45,730,888 - 45,786,901 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 45,705,947 - 45,761,905 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 45,705,946 - 45,761,904 NCBI Celera 3 45,668,700 - 45,724,522 (+) NCBI Celera Cytogenetic Map 3 p21.31 NCBI HuRef 3 45,775,115 - 45,830,941 (+) NCBI HuRef CHM1_1 3 45,680,731 - 45,736,559 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 45,705,375 - 45,761,083 (+) NCBI T2T-CHM13v2.0
Sacm1l Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 123,358,818 - 123,421,665 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 123,358,824 - 123,421,665 (+) Ensembl GRCm39 Ensembl GRCm38 9 123,529,753 - 123,592,600 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 123,529,759 - 123,592,600 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 123,439,000 - 123,501,716 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 123,378,580 - 123,441,296 (+) NCBI MGSCv36 mm8 Celera 9 123,982,316 - 124,047,496 (+) NCBI Celera Cytogenetic Map 9 F4 NCBI cM Map 9 74.08 NCBI
Sacm1l Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 132,053,465 - 132,109,857 (+) NCBI GRCr8 mRatBN7.2 8 123,176,017 - 123,232,413 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 123,172,536 - 123,232,413 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 128,765,500 - 128,828,247 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 126,964,469 - 127,027,208 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 124,793,995 - 124,856,731 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 132,607,166 - 132,663,502 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 132,607,166 - 132,663,502 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 131,759,866 - 131,816,202 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 128,302,927 - 128,359,950 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 128,322,663 - 128,379,687 (+) NCBI Celera 8 122,286,384 - 122,342,572 (+) NCBI Celera Cytogenetic Map 8 q32 NCBI
SACM1L Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 45,653,967 - 45,709,677 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 45,658,749 - 45,714,444 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 45,596,775 - 45,652,482 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 46,704,539 - 46,760,105 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 46,704,565 - 46,760,104 (+) Ensembl panpan1.1 panPan2
SACM1L Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 42,731,674 - 42,791,455 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 42,720,249 - 42,791,402 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 42,648,744 - 42,708,307 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 43,216,790 - 43,276,240 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 43,216,794 - 43,276,251 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 42,457,062 - 42,516,486 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 42,864,579 - 42,923,977 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 43,139,544 - 43,199,143 (-) NCBI UU_Cfam_GSD_1.0
Sacm1l
SACM1L Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 28,817,132 - 28,891,685 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 28,816,977 - 28,906,503 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 31,719,695 - 31,794,148 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SACM1L Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 7,159,701 - 7,214,368 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 7,159,809 - 7,214,555 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 159,951,795 - 160,006,471 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sacm1l
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSCLAT00000020822 ⟹ ENSCLAP00000020624
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 Ensembl NW_004955420 26,229,840 - 26,280,516 (-) Ensembl
RefSeq Acc Id:
XM_005383470 ⟹ XP_005383527
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 NW_004955420 26,231,597 - 26,280,516 (-) NCBI
Sequence:
TCGACTCTTTCACTGGTCTCGTGTCAAGACGTTTCTCGCACTGCCTGCCTTACACTAGTTTGTCCCTCACTGCCTCCCGTTCGCGCCTGTTCCTTTCCGCGGGGCGGAGAGACGGCTGGGGAGAGCCG
hide sequence
RefSeq Acc Id:
XP_005383527 ⟸ XM_005383470
- UniProtKB:
A0A8C2W1M9 (UniProtKB/TrEMBL)
- Sequence:
MMAATTYERLKLHITPEKFYVEACDDGADDVLTIDRVSTEVTLAVKKDVPPSAVTRPIFGILGTIHLVAGNYLIVITKKTKIGEFFNHVIWKATDFDILSYKKTMLHLTDIQLQDNKTFLAMLNNVLS
hide sequence
Ensembl Acc Id:
ENSCLAP00000020624 ⟸ ENSCLAT00000020822
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-06-06
Sacm1l
SAC1 like phosphatidylinositide phosphatase
SAC1 suppressor of actin mutations 1 like (yeast)
Symbol and/or name change
5135510 APPROVED
2017-02-28
Sacm1l
SAC1 suppressor of actin mutations 1 like (yeast)
SAC1 suppressor of actin mutations 1-like (yeast)
Symbol and/or name change
5135510 APPROVED
