Symbol:
Tnr
Name:
tenascin R
RGD ID:
737228
MGI Page
MGI
Description:
Predicted to enable integrin binding activity. Involved in several processes, including modulation of chemical synaptic transmission; negative regulation of neuron projection development; and regulation of cell migration. Acts upstream of or within several processes, including locomotory exploration behavior; modulation of chemical synaptic transmission; and negative regulation of axon extension involved in regeneration. Located in cell surface; membrane raft; and perineuronal net. Part of tenascin complex. Is active in Schaffer collateral - CA1 synapse and glutamatergic synapse. Is expressed in several structures, including aorta tunica media; brain; heart; urinary system; and ventral grey horn. Orthologous to human TNR (tenascin R).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
J1-ten; J1-tenascin; ja; janusin; neural recognition molecule J1-160/180; rest; restrictin; tenascin-R; TN; TN-R
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TNR (tenascin R) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Rattus norvegicus (Norway rat):
Tnr (tenascin R) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tnr (tenascin R) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TNR (tenascin R) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TNR (tenascin R) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tnr (tenascin R) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TNR (tenascin R) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TNR (tenascin R) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tnr (tenascin R) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
TNN (tenascin N) HGNC
OrthoMCL
Homo sapiens (human):
TNXB (tenascin XB) HGNC
OrthoMCL
Homo sapiens (human):
TNC (tenascin C) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Tnr (tenascin R)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
TNR (tenascin R)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tnr (tenascin R (restrictin, janusin))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
CG10359
Alliance
DIOPT (Ensembl Compara|PANTHER)
Drosophila melanogaster (fruit fly):
CG1791
Alliance
DIOPT (Ensembl Compara|PANTHER)
Drosophila melanogaster (fruit fly):
CG1889
Alliance
DIOPT (Ensembl Compara|PANTHER)
Drosophila melanogaster (fruit fly):
CG31832
Alliance
DIOPT (Ensembl Compara|PANTHER)
Drosophila melanogaster (fruit fly):
CG5550
Alliance
DIOPT (Ensembl Compara|PANTHER)
Drosophila melanogaster (fruit fly):
CG6788
Alliance
DIOPT (Ensembl Compara|PANTHER)
Drosophila melanogaster (fruit fly):
CG8642
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus tropicalis (tropical clawed frog):
tnr
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 159,351,170 - 159,759,299 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 159,351,339 - 159,759,299 (+) Ensembl GRCm39 Ensembl GRCm38 1 159,523,729 - 159,931,729 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 159,523,769 - 159,931,729 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 161,453,900 - 161,855,053 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 161,360,446 - 161,761,152 (+) NCBI MGSCv36 mm8 Celera 1 161,927,416 - 162,333,803 (+) NCBI Celera Cytogenetic Map 1 H1 NCBI cM Map 1 69.03 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tnr Mouse (+)-pilocarpine increases expression ISO RGD:3886 6480464 Pilocarpine results in increased expression of TNR protein CTD PMID:15120744 Tnr Mouse 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RGD:3886 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of TNR mRNA CTD PMID:27291303 Tnr Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:3886 6480464 Tetrachlorodibenzodioxin results in decreased expression of TNR mRNA CTD PMID:32109520|PMID:33387578 Tnr Mouse 2-amino-4,6-dinitrotoluene affects expression ISO RGD:3886 6480464 2-amino-4,6-dinitrotoluene affects the expression of TNR mRNA CTD PMID:21346803 Tnr Mouse 3,4-methylenedioxymethamphetamine decreases expression ISO RGD:3886 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of TNR mRNA CTD PMID:30071829 Tnr Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of TNR mRNA CTD PMID:39298647 Tnr Mouse 6-propyl-2-thiouracil decreases expression ISO RGD:3886 6480464 Propylthiouracil results in decreased expression of TNR mRNA CTD PMID:30047161 Tnr Mouse aflatoxin B1 decreases methylation ISO RGD:732585 6480464 Aflatoxin B1 results in decreased methylation of TNR gene CTD PMID:27153756 Tnr Mouse amitrole decreases expression ISO RGD:3886 6480464 Amitrole results in decreased expression of TNR mRNA CTD PMID:30047161 Tnr Mouse ammonium chloride affects expression ISO RGD:3886 6480464 Ammonium Chloride affects the expression of TNR mRNA CTD PMID:16483693 Tnr Mouse arsane decreases expression EXP 6480464 Arsenic results in decreased expression of TNR mRNA CTD PMID:24019935 Tnr Mouse arsenic atom decreases expression EXP 6480464 Arsenic results in decreased expression of TNR mRNA CTD PMID:24019935 Tnr Mouse benzo[a]pyrene affects methylation ISO RGD:732585 6480464 Benzo(a)pyrene affects the methylation of TNR 5' UTR CTD PMID:27901495 Tnr Mouse benzo[e]pyrene increases methylation ISO RGD:732585 6480464 benzo(e)pyrene results in increased methylation of TNR intron CTD PMID:30157460 Tnr Mouse bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:732585 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in decreased methylation of TNR more ... CTD PMID:33872906 Tnr Mouse bisphenol A increases expression ISO RGD:3886 6480464 bisphenol A results in increased expression of TNR mRNA CTD PMID:27178563 Tnr Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TNR mRNA CTD PMID:32156529 Tnr Mouse bisphenol A multiple interactions ISO RGD:732585 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of TNR gene CTD PMID:31601247 Tnr Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TNR mRNA CTD PMID:35598803 Tnr Mouse bisphenol A decreases expression ISO RGD:3886 6480464 bisphenol A results in decreased expression of TNR mRNA CTD PMID:25181051 Tnr Mouse Brodifacoum increases expression ISO RGD:3886 6480464 bromfenacoum results in increased expression of TNR protein CTD PMID:28903499 Tnr Mouse cadmium dichloride increases expression ISO RGD:3886 6480464 Cadmium Chloride results in increased expression of TNR mRNA CTD PMID:33453195 Tnr Mouse cadmium dichloride increases expression ISO RGD:732585 6480464 Cadmium Chloride results in increased expression of TNR mRNA CTD PMID:38568856 Tnr Mouse chlorpyrifos decreases expression ISO RGD:3886 6480464 Chlorpyrifos results in decreased expression of TNR mRNA CTD PMID:18668222 Tnr Mouse clobetasol decreases expression EXP 6480464 Clobetasol results in decreased expression of TNR mRNA CTD PMID:27462272 Tnr Mouse copper(II) sulfate increases expression ISO RGD:732585 6480464 Copper Sulfate results in increased expression of TNR mRNA CTD PMID:19549813 Tnr Mouse decabromodiphenyl ether decreases expression ISO RGD:3886 6480464 decabromobiphenyl ether results in decreased expression of TNR mRNA CTD PMID:23640034 Tnr Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of TNR mRNA CTD PMID:30319688 Tnr Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of TNR mRNA CTD PMID:30319688 Tnr Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of TNR mRNA CTD PMID:25629700 Tnr Mouse fulvestrant multiple interactions ISO RGD:732585 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of TNR gene CTD PMID:31601247 Tnr Mouse gentamycin decreases expression ISO RGD:3886 6480464 Gentamicins results in decreased expression of TNR mRNA CTD PMID:33387578 Tnr Mouse glyphosate increases expression EXP 6480464 Glyphosate results in increased expression of TNR mRNA CTD PMID:35489704 Tnr Mouse ivermectin decreases expression ISO RGD:732585 6480464 Ivermectin results in decreased expression of TNR protein CTD PMID:32959892 Tnr Mouse lead(0) decreases expression ISO RGD:732585 6480464 Lead results in decreased expression of TNR mRNA CTD PMID:19921347 Tnr Mouse maneb multiple interactions EXP 6480464 [Maneb co-treated with Paraquat] results in decreased expression of TNR mRNA CTD PMID:23017109|PMID:36117858 Tnr Mouse methapyrilene increases methylation ISO RGD:732585 6480464 Methapyrilene results in increased methylation of TNR intron CTD PMID:30157460 Tnr Mouse methimazole decreases expression ISO RGD:3886 6480464 Methimazole results in decreased expression of TNR mRNA CTD PMID:30047161 Tnr Mouse microcystin-LR increases expression EXP 6480464 cyanoginosin LR results in increased expression of TNR mRNA CTD PMID:37342990 Tnr Mouse mono(2-ethylhexyl) phthalate multiple interactions ISO RGD:732585 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in decreased methylation of TNR more ... CTD PMID:33872906 Tnr Mouse N-methyl-4-phenylpyridinium decreases expression ISO RGD:3886 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of TNR mRNA CTD PMID:28801915 Tnr Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ... CTD PMID:34911549 Tnr Mouse paraquat multiple interactions EXP 6480464 [Maneb co-treated with Paraquat] results in decreased expression of TNR mRNA CTD PMID:23017109|PMID:36117858 Tnr Mouse perfluorooctanoic acid affects methylation ISO RGD:732585 6480464 perfluorooctanoic acid affects the methylation of TNR gene CTD PMID:35266797 Tnr Mouse potassium dichromate increases expression EXP 6480464 Potassium Dichromate results in increased expression of TNR mRNA CTD PMID:23608068 Tnr Mouse propanal decreases expression ISO RGD:732585 6480464 propionaldehyde results in decreased expression of TNR mRNA CTD PMID:26079696 Tnr Mouse serpentine asbestos increases methylation ISO RGD:732585 6480464 Asbestos, Serpentine results in increased methylation of TNR 5' UTR CTD PMID:29523930 Tnr Mouse silver atom increases expression EXP 6480464 Silver results in increased expression of TNR mRNA CTD PMID:27131904 Tnr Mouse silver(0) increases expression EXP 6480464 Silver results in increased expression of TNR mRNA CTD PMID:27131904 Tnr Mouse sulfadimethoxine decreases expression ISO RGD:3886 6480464 Sulfadimethoxine results in decreased expression of TNR mRNA CTD PMID:30047161 Tnr Mouse tamoxifen increases expression ISO RGD:732585 6480464 Tamoxifen results in increased expression of TNR mRNA CTD PMID:15590111 Tnr Mouse toluene increases expression ISO RGD:3886 6480464 Toluene results in increased expression of TNR mRNA CTD PMID:22967744 Tnr Mouse trichloroethene decreases expression ISO RGD:3886 6480464 Trichloroethylene results in decreased expression of TNR mRNA CTD PMID:33387578 Tnr Mouse valproic acid affects splicing ISO RGD:3886 6480464 Valproic Acid affects the splicing of TNR mRNA CTD PMID:29427782 Tnr Mouse valproic acid decreases expression ISO RGD:3886 6480464 Valproic Acid results in decreased expression of TNR mRNA CTD PMID:29427782
Imported Annotations - KEGG (archival)
(+)-pilocarpine (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-amino-4,6-dinitrotoluene (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (EXP) 6-propyl-2-thiouracil (ISO) aflatoxin B1 (ISO) amitrole (ISO) ammonium chloride (ISO) arsane (EXP) arsenic atom (EXP) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Brodifacoum (ISO) cadmium dichloride (ISO) chlorpyrifos (ISO) clobetasol (EXP) copper(II) sulfate (ISO) decabromodiphenyl ether (ISO) ethanol (EXP) folic acid (EXP) fulvestrant (ISO) gentamycin (ISO) glyphosate (EXP) ivermectin (ISO) lead(0) (ISO) maneb (EXP) methapyrilene (ISO) methimazole (ISO) microcystin-LR (EXP) mono(2-ethylhexyl) phthalate (ISO) N-methyl-4-phenylpyridinium (ISO) ozone (EXP) paraquat (EXP) perfluorooctanoic acid (ISO) potassium dichromate (EXP) propanal (ISO) serpentine asbestos (ISO) silver atom (EXP) silver(0) (EXP) sulfadimethoxine (ISO) tamoxifen (ISO) toluene (ISO) trichloroethene (ISO) valproic acid (ISO)
Tnr Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 159,351,170 - 159,759,299 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 159,351,339 - 159,759,299 (+) Ensembl GRCm39 Ensembl GRCm38 1 159,523,729 - 159,931,729 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 159,523,769 - 159,931,729 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 161,453,900 - 161,855,053 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 161,360,446 - 161,761,152 (+) NCBI MGSCv36 mm8 Celera 1 161,927,416 - 162,333,803 (+) NCBI Celera Cytogenetic Map 1 H1 NCBI cM Map 1 69.03 NCBI
TNR Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 175,315,194 - 175,743,595 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 175,315,194 - 175,743,595 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 175,284,330 - 175,712,731 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 173,558,558 - 173,979,375 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 172,023,591 - 172,107,588 NCBI Celera 1 148,402,646 - 148,823,466 (-) NCBI Celera Cytogenetic Map 1 q25.1 NCBI HuRef 1 146,518,289 - 146,939,502 (-) NCBI HuRef CHM1_1 1 176,714,839 - 177,136,331 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 174,669,251 - 175,098,445 (-) NCBI T2T-CHM13v2.0
Tnr Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 74,285,141 - 74,706,174 (+) NCBI GRCr8 mRatBN7.2 13 71,751,714 - 72,172,731 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 72,091,585 - 72,167,641 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 74,669,906 - 74,745,851 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 75,968,796 - 76,044,850 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 73,228,183 - 73,304,243 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 77,602,249 - 77,678,385 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 77,485,113 - 77,678,437 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 82,511,491 - 82,587,627 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 75,271,116 - 75,347,181 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 75,285,303 - 75,361,369 (+) NCBI Celera 13 71,896,221 - 71,972,111 (+) NCBI Celera Cytogenetic Map 13 q22 NCBI
Tnr Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 15,088,843 - 15,282,937 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 15,007,248 - 15,512,219 (-) NCBI ChiLan1.0 ChiLan1.0
TNR Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 73,986,128 - 74,416,537 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 73,659,533 - 74,089,881 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 150,826,892 - 151,257,301 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 154,532,462 - 154,954,416 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 154,532,582 - 154,615,538 (-) Ensembl panpan1.1 panPan2
TNR Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 23,721,227 - 24,125,183 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 24,019,095 - 24,122,530 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 23,245,784 - 23,649,456 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 23,467,664 - 23,871,975 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 23,467,781 - 23,877,432 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 23,381,542 - 23,790,688 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 23,472,927 - 23,881,710 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 23,616,133 - 24,025,964 (+) NCBI UU_Cfam_GSD_1.0
Tnr Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 94,739,675 - 95,125,605 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936481 12,787,536 - 12,965,327 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936481 12,586,460 - 12,972,348 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TNR Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 117,373,545 - 117,771,224 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 117,365,930 - 117,790,332 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 129,110,238 - 129,553,412 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TNR
Tnr
.
Predicted Target Of
Count of predictions: 164 Count of miRNA genes: 150 Interacting mature miRNAs: 161 Transcripts: ENSMUST00000111669 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1301523 Ccrs1_m corpus callosum hemisphere surface size 1 (mouse) Not determined 1 139602037 173602216 Mouse 27226779 Tibl1_m tibia length 1, 5 week (mouse) 1 95527725 162027569 Mouse 10412185 Hcs9_m hepatocarcinogenesis susceptibility 9 (mouse) Not determined 1 63854690 189303617 Mouse 13824984 Twq5_m testis weight QTL 5 (mouse) 1 3069992 184732197 Mouse 12790984 Pcho7_m plasma cholesterol 7 (mouse) 1 147219390 181219390 Mouse 27226767 Tibl10_m tibia length 10, 10 week (mouse) 1 121727729 164827569 Mouse 1300740 Tne1_m total number errors (mouse) Not determined 1 139602037 173602216 Mouse 12790996 Aath2_m aortic arch atherosclerosis 2 (mouse) 1 145077630 179077630 Mouse 12791001 Aath6_m aortic arch atherosclerosis 6 (mouse) 1 147219390 181219390 Mouse 1300745 Gvhd1_m graft-versus-host disease 1 (mouse) Not determined 1 157456299 191456436 Mouse 10412162 Nobq3_m New Zealand obese QTL 3 (mouse) Not determined 1 103933405 191225397 Mouse 4141346 Skmw12_m skeletal muscle weight 12 (mouse) Not determined 150756737 184756922 Mouse 1357618 Splq5_m spleen weight QTL 5 (mouse) Not determined 1 150193673 188359312 Mouse 1301301 Sle1_m systemic lupus erythmatosus susceptibility 1 (mouse) Not determined 1 152038741 186038913 Mouse 1301818 Ap1q_m alcohol preference 1 QTL (mouse) Not determined 1 146908199 167586222 Mouse 12904936 Edlmmq1_m extensor digitorum longus muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 4141075 Bmd1a_m bone mineral density 1a (mouse) Not determined 1 155837814 162145325 Mouse 1301565 Mnotch_m modifier of Notch (mouse) Not determined 1 157456299 191456436 Mouse 27226799 Feml5_m femur length 5, 5 week (mouse) 1 122027729 164827569 Mouse 1301025 Lbw7_m lupus NZB x NZW 7 (mouse) Not determined 1 152038741 186038913 Mouse 12904944 Tammq1_m tibialis anterior muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1357602 Vtbt2_m vertebral trabecular bone trait 2 (mouse) Not determined 1 139602037 173602216 Mouse 12904957 Gmmq1_m gastrocnemius muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1300777 Chol10_m cholesterol 10 (mouse) Not determined 9 147875502 181875616 Mouse 1302098 Eila1_m ethanol induced locomotor activity 1 (mouse) Not determined 1 112008822 175468938 Mouse 1300571 Opfa_m open field activity (mouse) Not determined 1 144531347 178531592 Mouse 4141165 Bglu3_m blood glucose level 3 (mouse) Not determined 155831765 189831892 Mouse 1357889 Lprq3_m lipoprotein QTL 3 (mouse) Not determined 1 152038741 186038913 Mouse 4141160 Cq1_m cholesterol QTL 1 (mouse) Not determined 1 139452188 173452308 Mouse 4142182 Shali5_m survival time to hyperoxic acute lung injury 5 (mouse) Not determined 155582237 185994196 Mouse 10402498 Lmr20_m leishmaniasis resistance 20 (mouse) Not determined 1 158468817 192468938 Mouse 1301619 Cafq1_m caffeine metabolism QTL 1 (mouse) Not determined 1 155716221 189716369 Mouse 4141149 Hbnr4_m Heligmosomoides bakeri nematode resistance 4 (mouse) Not determined 147125258 188983224 Mouse 10043899 Hdlq99_m HDL QTL 99 (mouse) Not determined 1 147875502 181875616 Mouse 1302128 Ity3_m immunity to S. typhimurium 3 (mouse) Not determined 11 131156308 165139464 Mouse 11537365 Cnes4_m C. neoformans susceptibility locus 4 (mouse) 1 144449142 178449142 Mouse 11081167 Tir8_m trypanosome infection response 8 (mouse) 1 155716221 189716369 Mouse 1302132 Pbw1_m pentobarbital withdrawal QTL 1 (mouse) Not determined 1 155831765 189831892 Mouse 1357434 Obsty1_m obesity 1 (mouse) Not determined 1 136209950 170210094 Mouse 4142159 Nba2_m New Zealand Black autoimmunity 2 (mouse) Not determined 151835111 185835280 Mouse 1301602 Bslm4_m basal locomotor activity 4 (mouse) Not determined 1 157456299 191456436 Mouse 1301866 Cplaq3_m circadian period of locomotor activity 3 (mouse) Not determined 1 155721528 189722608 Mouse 1300842 Sle9_m systematic lupus erythematosus susceptibility 9 (mouse) Not determined 1 158468817 192468938 Mouse 4142149 Ctex_m Ctla4 expression QTL (mouse) Not determined 1 153557406 175468938 Mouse 1301608 Emo3_m emotionality 3 (mouse) Not determined 1 129130858 163130993 Mouse 1301614 Cgnz1_m chronic glomerulonephritis in NZM 1 (mouse) Not determined 1 152038741 186038913 Mouse 12910521 Scgq1_m spontaneous crescentic glomerulonephritis QTL 1 (mouse) 1 156602037 176262693 Mouse 12910522 Scgq2_m spontaneous crescentic glomerulonephritis QTL 2 (mouse) 1 147125258 171632257 Mouse 11039528 Ccc3_m colitis susceptibility in the Collaborative Cross 3 (mouse) 1 3680142 195051546 Mouse 4142014 Wbcq5_m white blood cell quantitative locus 5 (mouse) Not determined 1 141095010 175095156 Mouse 4141245 Cq2_m cholesterol QTL 2 (mouse) Not determined 1 157456299 191456436 Mouse 4141244 Bmd5c_m bone mineral density 5c (mouse) Not determined 155526796 189526897 Mouse 14746980 Manh50_m mandible shape 50 (mouse) 1 134131564 168131564 Mouse 13464138 Hdlq107_m HDL QTL 107 (mouse) 1 152132744 186132744 Mouse 1301151 Hdlq14_m HDL QTL 14 (mouse) Not determined 1 142489543 176489734 Mouse 1301149 Lrnx12_m learning-contextual 12 (mouse) Not determined 1 112008822 168186402 Mouse 4141233 Femwf12_m femur work to failure 12 (mouse) Not determined 141233173 175233272 Mouse 1300611 Tlln_m tail length (mouse) Not determined 1 155837814 159390372 Mouse 1301122 Cd8mts1_m CD8 T memory cell subset 1 (mouse) Not determined 1 155831765 189831892 Mouse 1301894 Skull2_m skull morphology 2 (mouse) Not determined 1 139602037 173602216 Mouse 1301385 Radpf2_m radiation pulmonary fibrosis 2 (mouse) Not determined 1 147125258 182873798 Mouse 1301134 Bmd1_m bone mineral density 1 (mouse) Not determined 1 156602037 189303617 Mouse 13452397 Leusq4_m leucocytosis susceptibility QTL 4 (mouse) 1 156602037 170803640 Mouse 1357493 Lgaq3_m late growth adjusted QTL 3 (mouse) Not determined 1 150193673 188359312 Mouse 11251722 Ewc1_m ethanol withdrawal and consumption 1 (mouse) 1 152132744 186132744 Mouse 1302193 Cpfd1_m cerebellum pattern fissures (mouse) Not determined 1 139602037 173602216 Mouse 10043963 Obq25_m obesity QTL 25 (mouse) Not determined 1 154410512 188410512 Mouse 13452393 Ity3b_m immunity to S. typhimurium 3b (mouse) 1 156497439 172097436 Mouse 1301431 Pcho1_m plasma cholesterol 1 (mouse) Not determined 1 159262573 193262693 Mouse 13452394 Leusq1_m leucocytosis susceptibility QTL 1 (mouse) 1 156602037 168186402 Mouse 1301408 Lore8_m loss of righting induced by ethanol 8 (mouse) Not determined 1 135877901 169878015 Mouse 10412074 Nhdlt1_m non-HDL cholesterol and triglyceride levels 1 (mouse) Not determined 1 153675990 187676105 Mouse 1357485 Lgq4_m late growth QTL 4 (mouse) Not determined 1 150193673 188359312 Mouse 1301932 Ssta2_m susceptibility to Salmonella typhimurium antigens 2 (mouse) Not determined 1 155716221 189716369 Mouse 27095901 Scvln8_m sacral vertebrae length 2, 10 week (mouse) 1 94127725 172027567 Mouse 11049576 Lmr8a_m leishmaniasis resistance 8a (mouse) 1 139602037 173602216 Mouse 1301458 Skts8_m skin tumor susceptibility 8 (mouse) Not determined 1 135794822 169795012 Mouse 1301202 Yaa4_m Y-linked autoimmune acceleration 4 (mouse) Not determined 1 158468817 192468938 Mouse 10054490 Opefa_m open field activity (mouse) Not determined 1 153712853 187712853 Mouse 1300948 Fglu2_m fasting glucose 2 (mouse) Not determined 1 157456299 191456436 Mouse 1301467 Pcir1_m periosteal circumference 1 (mouse) Not determined 1 141233173 175233272 Mouse 1301722 Cia9_m collagen induced arthritis QTL 9 (mouse) Not determined 1 45783900 189303617 Mouse 1300696 Bpq2_m blood pressure QTL 2 (mouse) Not determined 1 139602037 173602216 Mouse 11059556 Lmr20b_m leishmaniasis resistance 20b (mouse) 1 158468817 192468938 Mouse 4141554 Cfmq1_m cystic fibrosis modifier QTL 1 (mouse) Not determined 1 152038741 186038913 Mouse 11059557 Lmr20a_m leishmaniasis resistance 20a (mouse) 1 158468817 192468938 Mouse 11059558 Lmr20c_m leishmaniasis resistance 20c (mouse) 1 158468817 192468938 Mouse 1301191 Stia1_m serum transfer induced arthritis 1 (mouse) Not determined 1 141233173 175233272 Mouse 1300934 Cfbw1_m cystic fibrosis body weight 1 (mouse) Not determined 1 145145207 179145325 Mouse 1301189 Lmr8_m leishmaniasis resistance 8 (mouse) Not determined 1 156602037 189303617 Mouse 1558720 Bpq8_m blood pressure QTL 8 (mouse) Not determined 1 143284665 177284803 Mouse 10766456 Sle21_m systematic lupus erythematosus susceptibility 21 (mouse) 1 155831765 189831892 Mouse 1301710 Bmd5_m bone mineral density 5 (mouse) Not determined 1 139602037 173602216 Mouse 27095935 Ulnl5_m ulna length 5, 10 week (mouse) 1 128727737 181327565 Mouse 1301232 Hcs7_m hepatocarcinogenesis susceptibility 7 (mouse) Not determined 1 156602037 168186402 Mouse 10054271 Nba9_m New Zealand Black autoimmunity 9 (mouse) Not determined 1 155525623 189527533 Mouse 10054270 Nba10_m New Zealand Black autoimmunity 10 (mouse) Not determined 1 152794822 186438620 Mouse 1357567 Nidd3k_m Nidd3 on KK-A<y> (mouse) Not determined 7 147125258 169038913 Mouse 4142291 Aec2_m autoimmune exocrinopathy 2 (mouse) Not determined 52457737 182250592 Mouse 1300732 Melm2_m melanoma modifier 2 (mouse) Not determined 1 157456299 191456436 Mouse 1301216 Cbm1_m cerebellum weight 1 (mouse) Not determined 1 157456299 191456436 Mouse 27095915 Scvln13_m sacral vertebrae length 2, 16 week (mouse) 1 117527730 179827565 Mouse 11533913 Rd6m1_m retinal degeneration 6 modifier 1 (mouse) 1 141233173 175233272 Mouse 26884448 Sklq1_m skull length QTL 1, 5 week (mouse) 1 75976637 181327565 Mouse 1300969 Sluc5_m susceptibility to lung cancer 5 (mouse) Not determined 1 151186243 185186402 Mouse
C86103
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 159,550,988 - 159,551,073 UniSTS GRCm38 MGSCv37 1 161,481,119 - 161,481,204 UniSTS GRCm37 Celera 1 161,954,649 - 161,954,734 UniSTS Cytogenetic Map 1 E2 UniSTS Whitehead/MRC_RH 1 2028.12 UniSTS
29.MMHAP6FRB11.seq
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 159,757,135 - 159,757,297 UniSTS GRCm38 MGSCv37 1 161,687,266 - 161,687,428 UniSTS GRCm37 Celera 1 162,165,622 - 162,165,784 UniSTS Cytogenetic Map 1 E2 UniSTS Whitehead/MRC_RH 1 2054.82 UniSTS Whitehead_YAC 1 UniSTS
D1Mit159
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 159,661,973 - 159,662,164 UniSTS GRCm38 MGSCv37 1 161,592,104 - 161,592,295 UniSTS GRCm37 Celera 1 162,070,282 - 162,070,455 UniSTS Cytogenetic Map 1 E2 UniSTS cM Map 1 81.6 UniSTS Whitehead Genetic 1 82.0 UniSTS
D1Mit159.1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 159,661,856 - 159,661,974 UniSTS GRCm38 MGSCv37 1 161,591,987 - 161,592,105 UniSTS GRCm37 Celera 1 162,070,165 - 162,070,283 UniSTS Cytogenetic Map 1 E2 UniSTS cM Map 1 81.6 UniSTS cM Map 1 UniSTS Whitehead_YAC 1 UniSTS
D1Mit219
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 159,562,662 - 159,562,802 UniSTS GRCm38 MGSCv37 1 161,492,793 - 161,492,933 UniSTS GRCm37 Celera 1 161,966,294 - 161,966,434 UniSTS Cytogenetic Map 1 E2 UniSTS cM Map 1 81.6 UniSTS Whitehead Genetic 1 82.0 UniSTS Whitehead_YAC 1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000111669 ⟹ ENSMUSP00000107298
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 159,565,080 - 159,751,967 (+) Ensembl GRCm38.p6 Ensembl 1 159,737,510 - 159,924,397 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000192069 ⟹ ENSMUSP00000141553
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 159,351,339 - 159,759,299 (+) Ensembl GRCm38.p6 Ensembl 1 159,523,769 - 159,931,729 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000192457 ⟹ ENSMUSP00000141509
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 159,677,967 - 159,691,219 (+) Ensembl GRCm38.p6 Ensembl 1 159,850,397 - 159,863,649 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000193325 ⟹ ENSMUSP00000141752
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 159,601,340 - 159,677,912 (+) Ensembl GRCm38.p6 Ensembl 1 159,773,770 - 159,850,342 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000195199
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 159,351,411 - 159,565,365 (+) Ensembl GRCm38.p6 Ensembl 1 159,523,841 - 159,737,795 (+) Ensembl
RefSeq Acc Id:
NM_022312 ⟹ NP_071707
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 159,351,339 - 159,752,492 (+) NCBI GRCm38 1 159,523,769 - 159,924,922 (+) NCBI MGSCv37 1 161,453,900 - 161,855,053 (+) RGD Celera 1 161,927,416 - 162,333,803 (+) RGD cM Map 1 ENTREZGENE
Sequence:
AGTAAGAGGGGAAAAGAGAGAGCTTGTGAGAGACAGCAGAGCGGTCCCAGGCTTCCTCATCTCGTTCACGTCAGAGGCAGGAACCGACTGTGCTAAGGCTGTTGGCTCAACACGCAGAGACAGAGCTG
hide sequence
RefSeq Acc Id:
XM_006496742 ⟹ XP_006496805
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 159,351,317 - 159,759,299 (+) NCBI GRCm38 1 159,523,729 - 159,931,729 (+) NCBI
Sequence:
AAAAATATGCTGCTGAAATTTCAGTAAGAGGGGAAAAGAGAGAGCTTGTGAGAGACAGCAGAGC
hide sequence
RefSeq Acc Id:
XM_006496743 ⟹ XP_006496806
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 159,517,907 - 159,759,299 (+) NCBI GRCm38 1 159,687,813 - 159,931,729 (+) NCBI
Sequence:
ATCCAGGCCTGGATGGAAGGCAGATGGCTGGGTACATAGAAAACCAGCTCCTGATGCTTAGATAGCGCAGGGAAAGCTGAGGGGTGATGGGAAGCAAGAGCACTTTCAATGTCACAAACAGGCAGAGA
hide sequence
RefSeq Acc Id:
XM_006496744 ⟹ XP_006496807
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 159,601,173 - 159,759,299 (+) NCBI GRCm38 1 159,753,377 - 159,931,729 (+) NCBI
Sequence:
GCTGGGAAGGGGACACACACACATAACCAGTAGGCAGAAGACAGAAGCAGGGGGCGGGGGGGGG
hide sequence
RefSeq Acc Id:
XM_006496745 ⟹ XP_006496808
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 159,351,170 - 159,759,299 (+) NCBI GRCm38 1 159,523,729 - 159,931,729 (+) NCBI
Sequence:
TGGGACTGTTTGACTCTTTAGAAAAGCAGTCTCCAAGAGTTTGTGGGTGCAGGGAGCCTGAACTCAGACTGTTCAAGAGGACCAAAGACGCGTTGCTTTTCTGTCCACTAGGGGGCTACTTGTAGAAG
hide sequence
RefSeq Acc Id:
XM_006496746 ⟹ XP_006496809
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 159,351,340 - 159,759,299 (+) NCBI GRCm38 1 159,523,729 - 159,931,729 (+) NCBI
Sequence:
GTAAGAGGGGAAAAGAGAGAGCTTGTGAGAGACAGCAGAGCGGTCCCAGGCTTCCTCATCTCGTTCACGTCAGAGGCAGGAACCGACTGTGCTAAGGCTGTTGGCTCAACACGCAGAGACAGAGCTGG
hide sequence
RefSeq Acc Id:
XM_030252974 ⟹ XP_030108834
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 159,436,335 - 159,759,299 (+) NCBI GRCm38 1 159,608,766 - 159,931,729 (+) NCBI
Sequence:
ACAGGACAGAGCATTGGGCCCTACTTATGGAATGGCTAGAACAACTTATCAAGAGAGGTCATGCTGGGTCCTTGCTAATAGTAATGGGAGATGCAGTGGTAATTACAACCATTATAATAGTTACACAG
hide sequence
RefSeq Acc Id:
XM_030252975 ⟹ XP_030108835
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 159,517,938 - 159,759,299 (+) NCBI GRCm38 1 159,687,813 - 159,931,729 (+) NCBI
Sequence:
GTACATAGAAAACCAGCTCCTGATGCTTAGATAGCGCAGGGAAAGCTGAGGGGTGATGGGAAGC
hide sequence
RefSeq Acc Id:
XM_030252977 ⟹ XP_030108837
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 159,351,292 - 159,759,299 (+) NCBI GRCm38 1 159,523,729 - 159,931,729 (+) NCBI
Sequence:
TAGAAGGCTGGGAAAAAAACAGCTTAAAAATATGCTGCTGAAATTTCAGTAAGAGGGGAAAAGA
hide sequence
RefSeq Acc Id:
XM_036163559 ⟹ XP_036019452
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 159,351,217 - 159,759,299 (+) NCBI
Sequence:
TGCAGGGAGCCTGAACTCAGACTGTTCAAGAGGACCAAAGACGCGTTGCTTTTCTGTCCACTAGGGGGCTACTTGTAGAAGGCTGGGAAAAAAACAGCTTAAAAATATGCTGCTGAAATTTCAGTAAG
hide sequence
RefSeq Acc Id:
XM_036163560 ⟹ XP_036019453
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 159,351,288 - 159,759,299 (+) NCBI
Sequence:
CTTGTAGAAGGCTGGGAAAAAAACAGCTTAAAAATATGCTGCTGAAATTTCAGTAAGAGGGGAA
hide sequence
RefSeq Acc Id:
XM_036163561 ⟹ XP_036019454
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 159,351,289 - 159,759,299 (+) NCBI
Sequence:
TTGTAGAAGGCTGGGAAAAAAACAGCTTAAAAATATGCTGCTGAAATTTCAGTAAGAGGGGAAAAGAGAGAGCTTGTGAGAGACAGCAGAGCGGTCCCAGGCTTCCTCATCTCGTTCACGTCAGAGGC
hide sequence
RefSeq Acc Id:
XM_036163563 ⟹ XP_036019456
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 159,517,907 - 159,759,299 (+) NCBI
Sequence:
ATCCAGGCCTGGATGGAAGGCAGATGGCTGGGTACATAGAAAACCAGCTCCTGATGCTTAGATAGCGCAGGGAAAGCTGAGGGGTGATGGGAAGCAAGAGCACTTTCAATGTCACAAACAGGCAGAGA
hide sequence
RefSeq Acc Id:
NP_071707 ⟸ NM_022312
- Peptide Label:
precursor
- UniProtKB:
A2RT70 (UniProtKB/Swiss-Prot), O88717 (UniProtKB/Swiss-Prot), Q8BYI9 (UniProtKB/Swiss-Prot)
- Sequence:
MGIDGETVVLKNMLIGVNLILLGSMLKPSECRLEVTTERAQRQTVEEEGGASSYNTSSKEQPMVFNHVYNINVPLESLCSSGLEASAEQDMSAEDDTLAEYIGQTSDHESQVTFTHKINLPKKACPCA
hide sequence
RefSeq Acc Id:
XP_006496805 ⟸ XM_006496742
- Peptide Label:
isoform X1
- UniProtKB:
A2RT70 (UniProtKB/Swiss-Prot), O88717 (UniProtKB/Swiss-Prot), Q8BYI9 (UniProtKB/Swiss-Prot)
- Sequence:
MGIDGETVVLKNMLIGVNLILLGSMLKPSECRLEVTTERAQRQTVEEEGGASSYNTSSKEQPMVFNHVYNINVPLESLCSSGLEASAEQDMSAEDDTLAEYIGQTSDHESQVTFTHKINLPKKACPCA
hide sequence
RefSeq Acc Id:
XP_006496808 ⟸ XM_006496745
- Peptide Label:
isoform X2
- Sequence:
MGIDGETVVLKNMLIGVNLILLGSMLKPSECRLEVTTERAQRQTVEEEGGASSYNTSSKEQPMVFNHVYNINVPLESLCSSGLEASAEQDMSAEDDTLAEYIGQTSDHESQVTFTHKINLPKKACPCA
hide sequence
RefSeq Acc Id:
XP_006496806 ⟸ XM_006496743
- Peptide Label:
isoform X1
- UniProtKB:
A2RT70 (UniProtKB/Swiss-Prot), O88717 (UniProtKB/Swiss-Prot), Q8BYI9 (UniProtKB/Swiss-Prot)
- Sequence:
MGIDGETVVLKNMLIGVNLILLGSMLKPSECRLEVTTERAQRQTVEEEGGASSYNTSSKEQPMV
hide sequence
RefSeq Acc Id:
XP_006496807 ⟸ XM_006496744
- Peptide Label:
isoform X1
- UniProtKB:
A2RT70 (UniProtKB/Swiss-Prot), O88717 (UniProtKB/Swiss-Prot), Q8BYI9 (UniProtKB/Swiss-Prot)
- Sequence:
MGIDGETVVLKNMLIGVNLILLGSMLKPSECRLEVTTERAQRQTVEEEGGASSYNTSSKEQPMV
hide sequence
RefSeq Acc Id:
XP_006496809 ⟸ XM_006496746
- Peptide Label:
isoform X3
- Sequence:
MPAVGEVTARRGSASVRKATRALTAQQPTALGGLQLQQRVPGDWSGVTIMELEPGLTYNISVYA
hide sequence
RefSeq Acc Id:
XP_030108837 ⟸ XM_030252977
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_030108834 ⟸ XM_030252974
- Peptide Label:
isoform X1
- UniProtKB:
Q8BYI9 (UniProtKB/Swiss-Prot), A2RT70 (UniProtKB/Swiss-Prot), O88717 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_030108835 ⟸ XM_030252975
- Peptide Label:
isoform X1
- UniProtKB:
Q8BYI9 (UniProtKB/Swiss-Prot), A2RT70 (UniProtKB/Swiss-Prot), O88717 (UniProtKB/Swiss-Prot)
Ensembl Acc Id:
ENSMUSP00000107298 ⟸ ENSMUST00000111669
Ensembl Acc Id:
ENSMUSP00000141752 ⟸ ENSMUST00000193325
Ensembl Acc Id:
ENSMUSP00000141509 ⟸ ENSMUST00000192457
Ensembl Acc Id:
ENSMUSP00000141553 ⟸ ENSMUST00000192069
RefSeq Acc Id:
XP_036019452 ⟸ XM_036163559
- Peptide Label:
isoform X1
- UniProtKB:
Q8BYI9 (UniProtKB/Swiss-Prot), A2RT70 (UniProtKB/Swiss-Prot), O88717 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036019453 ⟸ XM_036163560
- Peptide Label:
isoform X1
- UniProtKB:
Q8BYI9 (UniProtKB/Swiss-Prot), A2RT70 (UniProtKB/Swiss-Prot), O88717 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036019454 ⟸ XM_036163561
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_036019456 ⟸ XM_036163563
- Peptide Label:
isoform X2
RGD ID: 6875398 Promoter ID: EPDNEW_M1150 Type: initiation region Name: Tnr_1 Description: Mus musculus tenascin R , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M1151 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 159,523,841 - 159,523,901 EPDNEW
RGD ID: 6875400 Promoter ID: EPDNEW_M1151 Type: single initiation site Name: Tnr_2 Description: Mus musculus tenascin R , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M1150 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 159,798,064 - 159,798,124 EPDNEW
RGD ID: 6818618 Promoter ID: MM_KWN:2579 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain Transcripts: NM_022312 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 161,453,636 - 161,454,136 (+) MPROMDB
