FABP2 (fatty acid binding protein 2)

Advanced Search (OLGA)

Gene: FABP2 (fatty acid binding protein 2) Homo sapiens

Analyze

Symbol:

FABP2

Name:

fatty acid binding protein 2

RGD ID:

735842

HGNC Page

HGNC:3556

Description:

Enables long-chain fatty acid binding activity. Involved in intestinal lipid absorption. Predicted to be located in apical cortex and microvillus. Predicted to be active in cytosol and nucleus. Implicated in alcoholic liver cirrhosis; carotid stenosis; coronary artery disease; end stage renal disease; and obesity.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

FABPI; fatty acid binding protein 1; fatty acid binding protein 2, intestinal; fatty acid-binding protein 2; fatty acid-binding protein, intestinal; I-FABP; intestinal-type fatty acid-binding protein; MGC133132

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Fabp2 (fatty acid binding protein 2, intestinal)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Fabp2 (fatty acid binding protein 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Fabp2 (fatty acid binding protein 2)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	FABP2 (fatty acid binding protein 2)	NCBI	Ortholog
Canis lupus familiaris (dog):	FABP2 (fatty acid binding protein 2)	HGNC	HomoloGene, Inparanoid, NCBI, OMA, OrthoDB
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fabp2 (fatty acid binding protein 2)	NCBI	Ortholog
Sus scrofa (pig):	FABP2 (fatty acid binding protein 2)	HGNC	Ensembl, Inparanoid, NCBI, OrthoDB
Chlorocebus sabaeus (green monkey):	FABP2 (fatty acid binding protein 2)	NCBI	Ortholog
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Fabp2 (fatty acid binding protein 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fabp2 (fatty acid binding protein 2, intestinal)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fabp2 (fatty acid binding protein 2, intestinal)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Xenopus tropicalis (tropical clawed frog):	fabp2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus laevis (African clawed frog):	fabp2.L	Alliance	DIOPT (Xenbase)
Xenopus laevis (African clawed frog):	fabp2.S	Alliance	DIOPT (Xenbase)

Allele / Splice:

See ClinVar data

Is Marker For:

QTLs: BW127_H

Candidate Gene For:

BW441_H

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	119,317,250 - 119,322,138 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	119,317,250 - 119,322,138 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	120,238,405 - 120,243,293 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	120,457,853 - 120,462,766 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	120,596,008 - 120,600,921	NCBI
Celera	4	117,600,001 - 117,604,911 (-)	NCBI		Celera
Cytogenetic Map	4	q26	NCBI
HuRef	4	115,960,235 - 115,965,143 (-)	NCBI		HuRef
CHM1_1	4	120,214,972 - 120,219,883 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	122,622,352 - 122,627,246 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

alcoholic liver cirrhosis (IAGP)

carotid stenosis (IAGP)

coronary artery disease (IAGP)

Diabetic Nephropathies (IAGP)

end stage renal disease (IAGP)

Experimental Liver Cirrhosis (EXP)

Hypertriglyceridemia (IAGP)

Insulin Resistance (IAGP)

Metabolic Syndrome (IAGP)

Neurodevelopmental Disorders (IAGP)

obesity (IAGP)

Stroke (IAGP)

type 2 diabetes mellitus (IAGP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,6-trinitrobenzenesulfonic acid (ISO)

2,4,6-trinitrotoluene (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,4-dinitrotoluene (ISO)

2-palmitoylglycerol (EXP)

4,4'-diaminodiphenylmethane (ISO)

aflatoxin M1 (EXP)

ammonium chloride (ISO)

benzo[a]pyrene (EXP,ISO)

bexarotene (ISO)

bezafibrate (ISO)

bis(2-ethylhexyl) phthalate (ISO)

captan (ISO)

carbon nanotube (ISO)

clofibrate (ISO)

copper(II) sulfate (EXP)

corn oil (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (ISO)

dichlorine (ISO)

diclofenac (ISO)

difenoconazole (ISO)

endosulfan (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fenofibrate (ISO)

ferroheme b (ISO)

folpet (ISO)

furan (ISO)

heme b (ISO)

inulin (ISO)

iron atom (ISO)

iron(0) (ISO)

metformin (ISO)

microcystin-LR (ISO)

N-methyl-4-phenylpyridinium (EXP)

N-nitrosodiethylamine (ISO)

N-nitrosodimethylamine (ISO)

nordihydroguaiaretic acid (ISO)

oleic acid (ISO)

ozone (ISO)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

potassium dichromate (ISO)

pravastatin (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

propamocarb (ISO)

propiconazole (ISO)

rifaximin (EXP)

rotenone (ISO)

sodium dichromate (ISO)

tacrolimus hydrate (ISO)

tamoxifen (ISO)

tetrachloromethane (ISO)

thioacetamide (ISO)

troglitazone (ISO)

valproic acid (EXP)

vinclozolin (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

fatty acid metabolic process (IEA,ISO)

fatty acid transport (IBA,IEA,ISO)

intestinal absorption (IEA,ISO)

intestinal lipid absorption (IMP)

long-chain fatty acid transport (IEA,ISO)

Cellular Component

apical cortex (IEA,ISO)

cytoplasm (IEA)

cytosol (IBA,TAS)

microvillus (IEA,ISO)

nucleus (IBA)

Molecular Function

fatty acid binding (IEA,ISO,TAS)

lipid binding (IEA)

long-chain fatty acid binding (IBA,IDA,IEA)

long-chain fatty acid transmembrane transporter activity (IEA,ISO)

protein binding (IPI)

Phenotype Annotations Click to see Annotation Detail View

Human Phenotype

Abnormal circulating leptin concentration (IAGP)

Abnormality of tumor necrosis factor secretion (IAGP)

Fasting hyperinsulinemia (IAGP)

Hyperglycemia (IAGP)

Increased body weight (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	Intestinal FABP2 A54T polymorphism: association with insulin resistance and obesity in women.	Albala C, etal., Obes Res. 2004 Feb;12(2):340-5.
2.	An amino acid substitution in the human intestinal fatty acid binding protein is associated with increased fatty acid binding, increased fat oxidation, and insulin resistance.	Baier LJ, etal., J Clin Invest 1995 Mar;95(3):1281-7.
3.	The fatty acid-binding protein-2 A54T polymorphism is associated with renal disease in patients with type 2 diabetes.	Canani LH, etal., Diabetes. 2005 Nov;54(11):3326-30.
4.	The T 54 allele of the intestinal fatty acid-binding protein 2 is associated with a parental history of stroke.	Carlsson M, etal., J Clin Endocrinol Metab 2000 Aug;85(8):2801-4.
5.	Codon-54 polymorphism of the fatty acid-binding protein 2 gene is associated with elevation of fasting and postprandial triglyceride in type 2 diabetes.	Georgopoulos A, etal., J Clin Endocrinol Metab 2000 Sep;85(9):3155-60.
6.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
7.	Variation of the fatty acid binding protein 2 gene is not associated with obesity and insulin resistance in Japanese subjects.	Hayakawa T, etal., Metabolism. 1999 May;48(5):655-7.
8.	Effects of intestinal fatty acid-binding protein gene Ala54Thr polymorphism and beta3-adrenergic receptor gene Trp64Arg polymorphism on insulin resistance and fasting plasma glucose in young to older Japanese men.	Ishii T, etal., Metabolism. 2001 Nov;50(11):1301-7.
9.	Comparison of the acute response to meals enriched with cis- or trans-fatty acids on glucose and lipids in overweight individuals with differing FABP2 genotypes.	Lefevre M, etal., Metabolism. 2005 Dec;54(12):1652-8.
10.	Lack of association between the fatty acid binding protein 2 (FABP2) polymorphism with obesity and insulin resistance in two aboriginal populations from Chile.	Perez-Bravo F, etal., Acta Diabetol. 2006 Dec;43(4):93-8.
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	The role of FABP2 gene polymorphism in alcoholic cirrhosis.	Salguero ML, etal., Hepatol Res. 2005 Nov 8;.
14.	Thr54 allele of the FABP2 gene affects resting metabolic rate and visceral obesity.	Takakura Y, etal., Diabetes Res Clin Pract. 2005 Jan;67(1):36-42.
15.	Thr54 allele carriers of the Ala54Thr variant of FABP2 gene have associations with metabolic syndrome and hypertriglyceridemia in urban South Indians.	Vimaleswaran KS, etal., Metabolism. 2006 Sep;55(9):1222-6.
16.	Genetic variation of the intestinal fatty acid-binding protein 2 gene in carotid atherosclerosis.	Wanby P, etal., Vasc Med. 2005 May;10(2):103-8.
17.	Genetic risk for coronary artery disease in individuals with or without type 2 diabetes.	Yamada Y, etal., Mol Genet Metab. 2004 Apr;81(4):282-90.
18.	Effect of Creosote Bush-Derived NDGA on Expression of Genes Involved in Lipid Metabolism in Liver of High-Fructose Fed Rats: Relevance to NDGA Amelioration of Hypertriglyceridemia and Hepatic Steatosis.	Zhang H, etal., PLoS One. 2015 Sep 22;10(9):e0138203. doi: 10.1371/journal.pone.0138203. eCollection 2015.

Additional References at PubMed

PMID:1740333	PMID:2193826	PMID:2263509	PMID:2824476	PMID:3838313	PMID:8401509	PMID:8454101	PMID:8954037	PMID:9204553	PMID:9250601	PMID:9806794	PMID:10070036
PMID:10856711	PMID:11288045	PMID:11299043	PMID:11385507	PMID:11423496	PMID:11555846	PMID:11606480	PMID:11707533	PMID:11730822	PMID:11866034	PMID:12079887	PMID:12161503
PMID:12189904	PMID:12370850	PMID:12377750	PMID:12477932	PMID:12634920	PMID:12691171	PMID:12809489	PMID:12855223	PMID:12899384	PMID:14563446	PMID:14567680	PMID:14605999
PMID:14650352	PMID:14666368	PMID:14686962	PMID:15135251	PMID:15135268	PMID:15159243	PMID:15177133	PMID:15489334	PMID:15527447	PMID:15547295	PMID:15572430	PMID:15598690
PMID:15764642	PMID:15776585	PMID:15869758	PMID:16002819	PMID:16276364	PMID:16679929	PMID:16718625	PMID:16718632	PMID:16733910	PMID:16809903	PMID:16908951	PMID:16945373
PMID:17143557	PMID:17207965	PMID:17209184	PMID:17212611	PMID:17292994	PMID:17310796	PMID:17343826	PMID:17383953	PMID:17428383	PMID:17447159	PMID:17512303	PMID:17594477
PMID:17605029	PMID:17633563	PMID:17684408	PMID:17907115	PMID:17914506	PMID:17921407	PMID:17960769	PMID:17975119	PMID:17992640	PMID:18065580	PMID:18201778	PMID:18280114
PMID:18282109	PMID:18422024	PMID:18440731	PMID:18506375	PMID:18634911	PMID:18660489	PMID:18701184	PMID:18824579	PMID:19023099	PMID:19056482	PMID:19156719	PMID:19282863
PMID:19288030	PMID:19324445	PMID:19367093	PMID:19384318	PMID:19439328	PMID:19475463	PMID:19491387	PMID:19499240	PMID:19578796	PMID:19689066	PMID:19689828	PMID:19878569
PMID:19913121	PMID:19948975	PMID:19961041	PMID:20047744	PMID:20080390	PMID:20202768	PMID:20308031	PMID:20329566	PMID:20332099	PMID:20384434	PMID:20413122	PMID:20416077
PMID:20452482	PMID:20484485	PMID:20534879	PMID:20565774	PMID:20578207	PMID:20621703	PMID:20628086	PMID:20673868	PMID:20723947	PMID:21044950	PMID:21079390	PMID:21288588
PMID:21355293	PMID:21767383	PMID:21840466	PMID:21861348	PMID:21873635	PMID:21988832	PMID:22396741	PMID:22817827	PMID:22838187	PMID:23072901	PMID:23303383	PMID:23362142
PMID:23468166	PMID:23817228	PMID:23826253	PMID:23911300	PMID:24100750	PMID:24340071	PMID:24640155	PMID:24690233	PMID:24956227	PMID:25262933	PMID:25324448	PMID:25357227
PMID:25388378	PMID:25416956	PMID:25594612	PMID:25730055	PMID:25793701	PMID:25807642	PMID:25847235	PMID:25910212	PMID:26019038	PMID:26114190	PMID:26238699	PMID:26316042
PMID:26703680	PMID:26798632	PMID:27110575	PMID:27765895	PMID:27778448	PMID:28110600	PMID:28164671	PMID:28232029	PMID:28738793	PMID:28760427	PMID:28819290	PMID:28984785
PMID:29338565	PMID:29404926	PMID:29744713	PMID:29771764	PMID:29785495	PMID:30100046	PMID:30927395	PMID:31301805	PMID:32456678	PMID:32619856	PMID:32696562	PMID:32922199
PMID:32970496	PMID:33857216	PMID:34206471	PMID:34264553	PMID:34942410	PMID:35156780	PMID:35536089	PMID:35614607	PMID:35647197	PMID:36260646	PMID:36286801	PMID:36335131
PMID:36382874	PMID:36609803	PMID:36701395	PMID:36758511	PMID:36768285	PMID:37076872	PMID:38159016	PMID:39242607	PMID:39277188

Genomics

Comparative Map Data

FABP2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	119,317,250 - 119,322,138 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	119,317,250 - 119,322,138 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	120,238,405 - 120,243,293 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	120,457,853 - 120,462,766 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	120,596,008 - 120,600,921	NCBI
Celera	4	117,600,001 - 117,604,911 (-)	NCBI		Celera
Cytogenetic Map	4	q26	NCBI
HuRef	4	115,960,235 - 115,965,143 (-)	NCBI		HuRef
CHM1_1	4	120,214,972 - 120,219,883 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	122,622,352 - 122,627,246 (-)	NCBI		T2T-CHM13v2.0

Fabp2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	122,688,721 - 122,693,155 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	122,688,721 - 122,693,155 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	122,895,072 - 122,899,506 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	122,895,072 - 122,899,506 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	122,598,310 - 122,602,424 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	122,887,414 - 122,891,528 (+)	NCBI		MGSCv36	mm8
Celera	3	129,305,754 - 129,309,868 (+)	NCBI		Celera
Cytogenetic Map	3	G1	NCBI
cM Map	3	53.74	NCBI

Fabp2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	213,724,629 - 213,728,686 (+)	NCBI		GRCr8
mRatBN7.2	2	211,040,032 - 211,044,089 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	211,040,032 - 211,044,089 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	218,717,756 - 218,721,725 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	216,625,543 - 216,629,512 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	211,471,755 - 211,475,828 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	227,080,912 - 227,083,654 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	227,080,924 - 227,083,501 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	246,442,292 - 246,445,034 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	219,591,502 - 219,605,097 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	219,554,563 - 219,568,159 (+)	NCBI
Celera	2	203,465,826 - 203,473,400 (+)	NCBI		Celera
RH 3.4 Map	2	1537.1	RGD
Cytogenetic Map	2	q42	NCBI

Fabp2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955428	20,930,479 - 20,933,950 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955428	20,930,512 - 20,933,950 (+)	NCBI	ChiLan1.0	ChiLan1.0

FABP2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	117,095,776 - 117,098,841 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	117,388,095 - 117,395,765 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	111,505,269 - 111,510,197 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	122,055,544 - 122,060,461 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	122,055,544 - 122,060,461 (-)	Ensembl	panpan1.1		panPan2

FABP2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	32	38,244,065 - 38,248,093 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
ROS_Cfam_1.0	32	38,465,352 - 38,497,153 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	32	38,465,346 - 38,492,684 (-)	Ensembl		ROS_Cfam_1.0 Ensembl

Fabp2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405301	67,281,463 - 67,284,661 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936869	146,844 - 149,902 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936869	146,567 - 149,929 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FABP2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	104,464,342 - 104,470,480 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	104,464,342 - 104,468,059 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	112,120,922 - 112,124,639 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FABP2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	66,797,832 - 66,803,459 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	66,798,990 - 66,802,738 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	45,658,385 - 45,663,315 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in FABP2
25 total Variants

Clinical Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
NM_000134.4(FABP2):c.163A>G (p.Thr55Ala)	single nucleotide variant	FATTY ACID-BINDING PROTEIN, INTESTINAL, POLYMORPHISM OF [RCV000017958]\|not provided [RCV001650835]	Chr4:119320747 [GRCh38] Chr4:120241902 [GRCh37] Chr4:4q26	benign
GRCh38/hg38 4q26-35.2(chr4:118065569-190042639)x3	copy number gain	See cases [RCV000051785]	Chr4:118065569..190042639 [GRCh38] Chr4:118986724..190828225 [GRCh37] Chr4:119206172..191200788 [NCBI36] Chr4:4q26-35.2	pathogenic
GRCh38/hg38 4q22.3-28.3(chr4:96092893-136410207)x3	copy number gain	See cases [RCV000051776]	Chr4:96092893..136410207 [GRCh38] Chr4:97014044..137331362 [GRCh37] Chr4:97233067..137550812 [NCBI36] Chr4:4q22.3-28.3	pathogenic
GRCh38/hg38 4q22.2-32.3(chr4:92913386-165299707)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051775]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051775]\|See cases [RCV000051775]	Chr4:92913386..165299707 [GRCh38] Chr4:93834537..166220859 [GRCh37] Chr4:94053560..166440309 [NCBI36] Chr4:4q22.2-32.3	pathogenic
GRCh38/hg38 4q26-31.21(chr4:116630862-145429900)x1	copy number loss	See cases [RCV000053321]	Chr4:116630862..145429900 [GRCh38] Chr4:117552018..146351052 [GRCh37] Chr4:117771466..146570502 [NCBI36] Chr4:4q26-31.21	pathogenic
NM_000134.3(FABP2):c.380G>A (p.Arg127Lys)	single nucleotide variant	Malignant melanoma [RCV000074317]	Chr4:119319060 [GRCh38] Chr4:120240215 [GRCh37] Chr4:120459663 [NCBI36] Chr4:4q26	not provided
GRCh38/hg38 4q26-27(chr4:118360303-120924156)x1	copy number loss	See cases [RCV000138837]	Chr4:118360303..120924156 [GRCh38] Chr4:119281458..121845311 [GRCh37] Chr4:119500906..122064761 [NCBI36] Chr4:4q26-27	pathogenic
GRCh38/hg38 4q26(chr4:116090996-119545165)x1	copy number loss	See cases [RCV000138236]	Chr4:116090996..119545165 [GRCh38] Chr4:117012152..120466320 [GRCh37] Chr4:117231601..120685768 [NCBI36] Chr4:4q26	likely pathogenic
GRCh38/hg38 4q26(chr4:118858868-119856165)x3	copy number gain	See cases [RCV000139232]	Chr4:118858868..119856165 [GRCh38] Chr4:119780023..120777320 [GRCh37] Chr4:119999471..120996768 [NCBI36] Chr4:4q26	likely benign
GRCh38/hg38 4q26-28.3(chr4:117351881-133565667)x1	copy number loss	See cases [RCV000143207]	Chr4:117351881..133565667 [GRCh38] Chr4:118273037..134486822 [GRCh37] Chr4:118492485..134706272 [NCBI36] Chr4:4q26-28.3	pathogenic
GRCh37/hg19 4q26-35.2(chr4:119437495-190904301)x3	copy number gain	See cases [RCV000240392]	Chr4:119437495..190904301 [GRCh37] Chr4:4q26-35.2	pathogenic
GRCh37/hg19 4p16.3-q35.2(chr4:12440-190904441)x3	copy number gain	See cases [RCV000446653]	Chr4:12440..190904441 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
GRCh37/hg19 4p16.3-q35.2(chr4:68346-190957473)	copy number gain	See cases [RCV000510453]	Chr4:68346..190957473 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
GRCh37/hg19 4q25-35.2(chr4:109199664-189752726)x3	copy number gain	See cases [RCV000511945]	Chr4:109199664..189752726 [GRCh37] Chr4:4q25-35.2	pathogenic
GRCh37/hg19 4q22.1-35.2(chr4:93071152-190957473)x3	copy number gain	See cases [RCV000510970]	Chr4:93071152..190957473 [GRCh37] Chr4:4q22.1-35.2	pathogenic
GRCh37/hg19 4p16.3-q35.2(chr4:68346-190957473)x3	copy number gain	See cases [RCV000512241]	Chr4:68346..190957473 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
GRCh37/hg19 4q26-28.2(chr4:116307857-129302960)x1	copy number loss	not provided [RCV000682448]	Chr4:116307857..129302960 [GRCh37] Chr4:4q26-28.2	pathogenic
GRCh37/hg19 4q26(chr4:117108352-120317108)x1	copy number loss	not provided [RCV000682449]	Chr4:117108352..120317108 [GRCh37] Chr4:4q26	uncertain significance
GRCh37/hg19 4q26(chr4:120003576-120689244)x3	copy number gain	not provided [RCV000682453]	Chr4:120003576..120689244 [GRCh37] Chr4:4q26	likely benign
GRCh37/hg19 4p16.3-q35.2(chr4:49450-190915650)x3	copy number gain	not provided [RCV000743155]	Chr4:49450..190915650 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
GRCh37/hg19 4p16.3-q35.2(chr4:49450-190963766)x3	copy number gain	not provided [RCV000743156]	Chr4:49450..190963766 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
GRCh37/hg19 4p16.3-q35.2(chr4:11525-191028879)x3	copy number gain	not provided [RCV000743147]	Chr4:11525..191028879 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
NC_000004.12:g.119322182del	deletion	not provided [RCV001609713]	Chr4:119322182 [GRCh38] Chr4:120243337 [GRCh37] Chr4:4q26	benign
NM_000134.4(FABP2):c.241-136A>G	single nucleotide variant	not provided [RCV001708996]	Chr4:119319779 [GRCh38] Chr4:120240934 [GRCh37] Chr4:4q26	benign
NM_000134.4(FABP2):c.68-148G>A	single nucleotide variant	not provided [RCV001645264]	Chr4:119320990 [GRCh38] Chr4:120242145 [GRCh37] Chr4:4q26	benign
NM_000134.4(FABP2):c.68-167T>G	single nucleotide variant	not provided [RCV001645279]	Chr4:119321009 [GRCh38] Chr4:120242164 [GRCh37] Chr4:4q26	benign
NM_000134.4(FABP2):c.241-34TAT[13]	microsatellite	not provided [RCV001668074]	Chr4:119319647..119319648 [GRCh38] Chr4:120240802..120240803 [GRCh37] Chr4:4q26	benign
NM_000134.4(FABP2):c.241-34TAT[14]	microsatellite	not provided [RCV000946810]	Chr4:119319647..119319648 [GRCh38] Chr4:120240802..120240803 [GRCh37] Chr4:4q26	benign
Single allele	deletion	Neurodevelopmental disorder [RCV000787448]	Chr4:116624547..126168646 [GRCh37] Chr4:4q26-28.1	likely pathogenic
NM_000134.4(FABP2):c.240+179T>C	single nucleotide variant	not provided [RCV001609266]	Chr4:119320491 [GRCh38] Chr4:120241646 [GRCh37] Chr4:4q26	benign
NM_000134.4(FABP2):c.240+151G>A	single nucleotide variant	not provided [RCV001714747]	Chr4:119320519 [GRCh38] Chr4:120241674 [GRCh37] Chr4:4q26	benign
NM_000134.4(FABP2):c.*15G>A	single nucleotide variant	not provided [RCV001615744]	Chr4:119319026 [GRCh38] Chr4:120240181 [GRCh37] Chr4:4q26	benign
NM_000134.4(FABP2):c.240+166A>G	single nucleotide variant	not provided [RCV001681118]	Chr4:119320504 [GRCh38] Chr4:120241659 [GRCh37] Chr4:4q26	benign
NM_000134.4(FABP2):c.67+156C>T	single nucleotide variant	not provided [RCV001657514]	Chr4:119321880 [GRCh38] Chr4:120243035 [GRCh37] Chr4:4q26	benign
NM_000134.4(FABP2):c.216T>C (p.Asn72=)	single nucleotide variant	not provided [RCV001621265]	Chr4:119320694 [GRCh38] Chr4:120241849 [GRCh37] Chr4:4q26	benign
NM_000134.4(FABP2):c.241-34TAT[11]	microsatellite	not provided [RCV001654605]	Chr4:119319647..119319648 [GRCh38] Chr4:120240802..120240803 [GRCh37] Chr4:4q26	benign
NC_000004.12:g.119322237_119322238insCTCTA	insertion	not provided [RCV001674050]	Chr4:119322234..119322235 [GRCh38] Chr4:120243389..120243390 [GRCh37] Chr4:4q26	benign
NM_000134.4(FABP2):c.240+100G>T	single nucleotide variant	not provided [RCV001674761]	Chr4:119320570 [GRCh38] Chr4:120241725 [GRCh37] Chr4:4q26	benign
NM_000134.4(FABP2):c.*65A>G	single nucleotide variant	not provided [RCV001638490]	Chr4:119318976 [GRCh38] Chr4:120240131 [GRCh37] Chr4:4q26	benign
GRCh37/hg19 4q26(chr4:120191740-120248879)x1	copy number loss	not provided [RCV001005594]	Chr4:120191740..120248879 [GRCh37] Chr4:4q26	uncertain significance
NM_000134.4(FABP2):c.357A>G (p.Val119=)	single nucleotide variant	not provided [RCV001666870]	Chr4:119319083 [GRCh38] Chr4:120240238 [GRCh37] Chr4:4q26	benign
NM_000134.4(FABP2):c.67+262C>A	single nucleotide variant	not provided [RCV001707300]	Chr4:119321774 [GRCh38] Chr4:120242929 [GRCh37] Chr4:4q26	benign
GRCh37/hg19 4q26-28.2(chr4:116833638-130232122)	copy number loss	Atypical behavior [RCV001352657]	Chr4:116833638..130232122 [GRCh37] Chr4:4q26-28.2	pathogenic
NC_000004.12:g.119322356T>C	single nucleotide variant	not provided [RCV001679790]	Chr4:119322356 [GRCh38] Chr4:120243511 [GRCh37] Chr4:4q26	benign
NC_000004.12:g.119322197C>T	single nucleotide variant	not provided [RCV001654268]	Chr4:119322197 [GRCh38] Chr4:120243352 [GRCh37] Chr4:4q26	benign
NM_000134.4(FABP2):c.*252G>A	single nucleotide variant	not provided [RCV001615870]	Chr4:119318789 [GRCh38] Chr4:120239944 [GRCh37] Chr4:4q26	benign
NM_000134.4(FABP2):c.68-315G>A	single nucleotide variant	not provided [RCV001670434]	Chr4:119321157 [GRCh38] Chr4:120242312 [GRCh37] Chr4:4q26	benign
NM_000134.4(FABP2):c.241-34TAT[9]	microsatellite	not provided [RCV001652803]	Chr4:119319648..119319650 [GRCh38] Chr4:120240803..120240805 [GRCh37] Chr4:4q26	benign
GRCh37/hg19 4q26-28.3(chr4:114872547-138005267)x1	copy number loss	not provided [RCV001795851]	Chr4:114872547..138005267 [GRCh37] Chr4:4q26-28.3	pathogenic
GRCh37/hg19 4q24-31.21(chr4:104715235-145252595)	copy number gain	not specified [RCV002053446]	Chr4:104715235..145252595 [GRCh37] Chr4:4q24-31.21	pathogenic
GRCh37/hg19 4q26-28.2(chr4:116888785-129649979)	copy number loss	not specified [RCV002053451]	Chr4:116888785..129649979 [GRCh37] Chr4:4q26-28.2	pathogenic
GRCh37/hg19 4q26-27(chr4:119902254-121463237)	copy number gain	not specified [RCV002053452]	Chr4:119902254..121463237 [GRCh37] Chr4:4q26-27	uncertain significance
GRCh37/hg19 4q12-31.21(chr4:52866944-143582507)x3	copy number gain	not provided [RCV001827738]	Chr4:52866944..143582507 [GRCh37] Chr4:4q12-31.21	pathogenic
NM_000134.4(FABP2):c.304G>A (p.Glu102Lys)	single nucleotide variant	not specified [RCV004202202]	Chr4:119319580 [GRCh38] Chr4:120240735 [GRCh37] Chr4:4q26	uncertain significance
NM_000134.4(FABP2):c.317T>C (p.Val106Ala)	single nucleotide variant	not specified [RCV004146331]	Chr4:119319567 [GRCh38] Chr4:120240722 [GRCh37] Chr4:4q26	uncertain significance
NM_000134.4(FABP2):c.76A>G (p.Ile26Val)	single nucleotide variant	not specified [RCV004146332]	Chr4:119320834 [GRCh38] Chr4:120241989 [GRCh37] Chr4:4q26	likely benign
NM_000134.4(FABP2):c.68G>A (p.Gly23Asp)	single nucleotide variant	not specified [RCV004217058]	Chr4:119320842 [GRCh38] Chr4:120241997 [GRCh37] Chr4:4q26	uncertain significance
NM_000134.4(FABP2):c.286C>T (p.Arg96Trp)	single nucleotide variant	not specified [RCV004249127]	Chr4:119319598 [GRCh38] Chr4:120240753 [GRCh37] Chr4:4q26	uncertain significance
GRCh37/hg19 4q26(chr4:120191741-120245035)x1	copy number loss	not provided [RCV003485435]	Chr4:120191741..120245035 [GRCh37] Chr4:4q26	uncertain significance
GRCh37/hg19 4q26-32.3(chr4:117518683-168174703)x3	copy number gain	not provided [RCV003484198]	Chr4:117518683..168174703 [GRCh37] Chr4:4q26-32.3	pathogenic
NM_000134.4(FABP2):c.147A>C (p.Thr49=)	single nucleotide variant	not provided [RCV003435141]	Chr4:119320763 [GRCh38] Chr4:120241918 [GRCh37] Chr4:4q26	likely benign
GRCh37/hg19 4q24-35.2(chr4:101203509-190957473)x3	copy number gain	not specified [RCV003986496]	Chr4:101203509..190957473 [GRCh37] Chr4:4q24-35.2	pathogenic
GRCh37/hg19 4p12-q35.2(chr4:45455621-191003541)x3	copy number gain	not provided [RCV003885507]	Chr4:45455621..191003541 [GRCh37] Chr4:4p12-q35.2	pathogenic
NM_000134.4(FABP2):c.134G>A (p.Gly45Glu)	single nucleotide variant	not specified [RCV004378402]	Chr4:119320776 [GRCh38] Chr4:120241931 [GRCh37] Chr4:4q26	uncertain significance
NM_000134.4(FABP2):c.245C>T (p.Thr82Ile)	single nucleotide variant	not specified [RCV004378403]	Chr4:119319639 [GRCh38] Chr4:120240794 [GRCh37] Chr4:4q26	uncertain significance
NM_000134.4(FABP2):c.214A>T (p.Asn72Tyr)	single nucleotide variant	not specified [RCV004623157]	Chr4:119320696 [GRCh38] Chr4:120241851 [GRCh37] Chr4:4q26	uncertain significance
NM_000134.4(FABP2):c.127C>G (p.Gln43Glu)	single nucleotide variant	not specified [RCV004623159]	Chr4:119320783 [GRCh38] Chr4:120241938 [GRCh37] Chr4:4q26	uncertain significance
NM_000134.4(FABP2):c.272T>G (p.Ile91Ser)	single nucleotide variant	not specified [RCV004623160]	Chr4:119319612 [GRCh38] Chr4:120240767 [GRCh37] Chr4:4q26	uncertain significance

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	752
Count of miRNA genes:	448
Interacting mature miRNAs:	478
Transcripts:	ENST00000274024
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCh38)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1643256	BW127_H	Body Weight QTL 127 (human)	1.31	0.007	Body weight	body mass index	4	106319694	132319694	Human
407079015	GWAS727991_H	pulmonary embolism QTL GWAS727991 (human)		8e-17	pulmonary embolism		4	119320747	119320748	Human
407196112	GWAS845088_H	androsterone sulfate measurement QTL GWAS845088 (human)		0.000004	androsterone sulfate measurement		4	119318723	119318724	Human
407196751	GWAS845727_H	cGMP-specific 3',5'-cyclic phosphodiesterase measurement QTL GWAS845727 (human)		4e-12	cGMP-specific 3',5'-cyclic phosphodiesterase measurement		4	119320694	119320695	Human

Markers in Region

SHGC4-110

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	120,240,211 - 120,240,619	UniSTS	GRCh37
Build 36	4	120,459,659 - 120,460,067	RGD	NCBI36
Celera	4	117,601,807 - 117,602,215	RGD
Cytogenetic Map	4	q28-q31	UniSTS
HuRef	4	115,962,041 - 115,962,449	UniSTS
TNG Radiation Hybrid Map	4	73768.0	UniSTS

GDB:178665

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	120,240,775 - 120,240,878	UniSTS	GRCh37
Build 36	4	120,460,223 - 120,460,326	RGD	NCBI36
Celera	4	117,602,371 - 117,602,477	RGD
Cytogenetic Map	4	q28-q31	UniSTS
HuRef	4	115,962,605 - 115,962,717	UniSTS

SHGC-145405

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	120,242,866 - 120,243,175	UniSTS	GRCh37
Build 36	4	120,462,314 - 120,462,623	RGD	NCBI36
Celera	4	117,604,461 - 117,604,770	RGD
Cytogenetic Map	4	q28-q31	UniSTS
HuRef	4	115,964,693 - 115,965,002	UniSTS
TNG Radiation Hybrid Map	10	42794.0	UniSTS

PMC31346P1

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	120,241,733 - 120,242,108	UniSTS	GRCh37
Build 36	4	120,461,181 - 120,461,556	RGD	NCBI36
Celera	4	117,603,328 - 117,603,703	RGD
Cytogenetic Map	4	q28-q31	UniSTS
HuRef	4	115,963,560 - 115,963,935	UniSTS

FABP2_200

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	120,238,315 - 120,239,210	UniSTS	GRCh37
Build 36	4	120,457,763 - 120,458,658	RGD	NCBI36
Celera	4	117,599,911 - 117,600,806	RGD
HuRef	4	115,960,145 - 115,961,040	UniSTS

SHGC-59292

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	120,240,031 - 120,240,183	UniSTS	GRCh37
Build 36	4	120,459,479 - 120,459,631	RGD	NCBI36
Celera	4	117,601,627 - 117,601,779	RGD
Cytogenetic Map	4	q28-q31	UniSTS
HuRef	4	115,961,861 - 115,962,013	UniSTS
GeneMap99-GB4 RH Map	4	546.46	UniSTS
Whitehead-RH Map	4	597.7	UniSTS
NCBI RH Map	4	1251.6	UniSTS

SHGC4-8

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	120,240,730 - 120,240,934	UniSTS	GRCh37
Build 36	4	120,460,178 - 120,460,382	RGD	NCBI36
Celera	4	117,602,326 - 117,602,533	RGD
Cytogenetic Map	4	q28-q31	UniSTS
HuRef	4	115,962,560 - 115,962,773	UniSTS
Stanford-G3 RH Map	4	6747.0	UniSTS
NCBI RH Map	4	1228.1	UniSTS
GeneMap99-G3 RH Map	4	6693.0	UniSTS

SHGC-59542

Human Assembly	Chr	Position (strand)	Source
Cytogenetic Map	4	q28-q31	UniSTS
HuRef	4	115,962,852 - 115,963,027	UniSTS
GeneMap99-GB4 RH Map	4	556.1	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system
615	1577	1536	1403	1880	1004	1094	1	310	827	219	723	4303	3317	4	1607	382	1047	744	93

Sequence

Nucleotide Sequences


RefSeq Transcripts	NG_011444	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_000134	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC092656	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK025079	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC069466	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC069617	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC069625	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC069637	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC111791	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471229	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068274	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M18079	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MG948943	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000274024 ⟹ ENSP00000274024

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	4	119,317,250 - 119,322,138 (-)	Ensembl

RefSeq Acc Id:

NM_000134 ⟹ NP_000125

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	4	119,317,250 - 119,322,138 (-)	NCBI
GRCh37	4	120,238,405 - 120,243,316 (-)	ENTREZGENE
Build 36	4	120,457,853 - 120,462,766 (-)	NCBI Archive
HuRef	4	115,960,235 - 115,965,143 (-)	ENTREZGENE
CHM1_1	4	120,214,972 - 120,219,883 (-)	NCBI
T2T-CHM13v2.0	4	122,622,352 - 122,627,246 (-)	NCBI

Sequence:

show sequence

ATCTCTAGCTGCCTAGAGGCTGACTCAACTGAAATCATGGCGTTTGACAGCACTTGGAAGGTAG
ACCGGAGTGAAAACTATGACAAGTTCATGGAAAAAATGGGTGTTAATATAGTGAAAAGGAAGCT
TGCAGCTCATGACAATTTGAAGCTGACAATTACACAAGAAGGAAATAAATTCACAGTCAAAGAA
TCAAGCACTTTTCGAAACATTGAAGTTGTTTTTGAACTTGGTGTCACCTTTAATTACAATCTAG
CAGACGGAACTGAACTCAGGGGGACCTGGAGCCTTGAGGGAAATAAACTTATTGGAAAATTCAA
ACGGACAGACAATGGAAACGAACTGAATACTGTCCGAGAAATTATAGGTGATGAACTAGTCCAG
ACTTATGTATATGAAGGAGTAGAAGCCAAAAGGATCTTTAAAAAGGATTGAGCATTATTCTTGG
CGCACAGTCCAAAATACAAATTGGACAGAAGATCTATATTGTACCAGAACTATTTATTTCACCC
CATCAAGTATAAGGTTACTGATTGATTGGTCCTTTTATAAACATTGGTATATTTCCATTCATGC
CAAAGCAAAAGAAGTAAAAGCTAATTAGGATTTAATTTGTTTTATATTCTCTAAGATATATATT
TACTAAAAGAATTTGTGACATTTTAAAAAACAAAAATAAATATTGCGTCCATGTTGCTTTATAT
GTAGCCTTGCCTTTTAAAAGAAAAAGTATGTGAATATGAATTGACAGACTGTTTTCGTAGAGAG
AGGGTCTTACTCTTTCACTCAGGCTGGAATGTAGTGGAGAGATCATAGCTCACTGTAACCTCAA
ACTCCTGGACTCATGCAATCTTCCTGCCTCAGGCTTCTGAGTAGCTAGGACTATGGGTACATTC
CACAGTGCCCAGCTAATTTTTGTTTTGTTTTCTTTTTATTTTTTTTAGAGATGGGGTCTTGCTA
TATTGCCCAGGCTGGTCTTGAACCCCTGGCCTCAAGCAATCCTCCTGCCTCAGCCTCTCAAGTT
GTTTTTTTTCTTTACATTTGATAAACTAAAAGCATAGGCTGCATATGAGTCTTTAACATCTTGA
ACTGGTTGTGAATAATTTTCTGGCACTGGTTGTAAGTAATATCTATTATTATAAAAATAATATA
TGCTCAACCAGAAAACTTAGAAATAAGAAACACAAATGTAAAATAAGTATTTCCATAACTCATA
ATCCAGAGATAATTGCCATTCTGATTTTGATAGATATCCTCTCAGCTCTCTTCCCTGGGGGCAG
ATATTTCCCAATACATACCACTTTGAATAGGATGATAGGAAATAAATGATGTACTACATTAAAT
TAAATTATTGTATTACATTTTTGTACACATCAGTCATTCCCACGCTTGGCTGAAAATCAGGATC
ATCTGAGAAACTTAAACAATTTCTGCATTCTTAATCTCCACTGTTATTCTATTATATCAGAATC
GCTAATAGAACCAAGAATTCTAGAAAATTTCCTGGTGATTCTGATGCAGCCTGTCCACTAACTT
GTCTTTGAGAACAATGGAGATATCAGTTATCAATGTTATTTTTAACCACCCCCTTCTTTTTTGT
TGTTGTGGGTTTTTTCACATAAACACATACATTGCCAATTTTCCAGGGCTCAAAAAGTTTCCTT
TTATTCATATTTTCACATGACGTAAAATTTTATGTGCTTCACATAATTGTATTTTAGCAGGGTA
CATATTAGGGGATGGAGAGGGGGTACAATTTTTAAGCATTTGCAGCTGCAACTCTATAGACTTT
TGACAAATTCTTTTTCACACTGATGTAGATAACAGCTTAACATTTACATAGTTCTTACTACTTG
CCACACACTGTTCTAAGTGGTATATACATATGACATATATATTAAAATGTAGGAAGAAAAATGT
TTGAGTACCTGATGAAAATGAATAGAGAGTATGTAATCTTTGAAAGCTGAATACTGCGTGTTCT
CACTTATAAGTGGGAGCTAAATAATGTATACACATGGACACACCAGAGTGTAGAATAATAGACA
CTGGAGACTTGGAAGAGTTGGAGGGTTGGCAGGGGGCGATGATAATTTACTTAATGGGTACAAT
GTACATTATTCAGGGGGTGATGGTTACAGCCCAGACTTTACCACTATGCAATATATCAATGTAA
CAAAACTATACTTGTACTCCTTAAATTTATATAAAAATACCTTAAATCTA

hide sequence

Protein Sequences


Protein RefSeqs	NP_000125	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA52417	(Get FASTA)	NCBI Sequence Viewer
	AAH69466	(Get FASTA)	NCBI Sequence Viewer
	AAH69617	(Get FASTA)	NCBI Sequence Viewer
	AAH69625	(Get FASTA)	NCBI Sequence Viewer
	AAH69637	(Get FASTA)	NCBI Sequence Viewer
	AAI11792	(Get FASTA)	NCBI Sequence Viewer
	EAW73666	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000274024
	ENSP00000274024.3
GenBank Protein	P12104	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_000125 ⟸ NM_000134
- UniProtKB:	Q2NKJ1 (UniProtKB/Swiss-Prot), P12104 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSTFRNIEVVFE LGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRI FKKD hide sequence

Ensembl Acc Id:

ENSP00000274024 ⟸ ENST00000274024

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P12104-F1-model_v2	AlphaFold	P12104	1-132	view protein structure

Promoters

RGD ID:

6868366

Promoter ID:

EPDNEW_H7348

Type:

multiple initiation site

Name:

FABP2_1

Description:

fatty acid binding protein 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H7349

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	4	119,322,138 - 119,322,198	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	HGNC:3556	AgrOrtholog
COSMIC	FABP2	COSMIC
Ensembl Genes	ENSG00000145384	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000274024	ENTREZGENE
	ENST00000274024.4	UniProtKB/Swiss-Prot
Gene3D-CATH	2.40.128.20	UniProtKB/Swiss-Prot
GTEx	ENSG00000145384	GTEx
HGNC ID	HGNC:3556	ENTREZGENE
Human Proteome Map	FABP2	Human Proteome Map
InterPro	Calycin	UniProtKB/Swiss-Prot
	FABP2	UniProtKB/Swiss-Prot
	Fatty_acid-bd	UniProtKB/Swiss-Prot
	ILBP	UniProtKB/Swiss-Prot
	Lipocln_cytosolic_FA-bd_dom	UniProtKB/Swiss-Prot
KEGG Report	hsa:2169	UniProtKB/Swiss-Prot
NCBI Gene	2169	ENTREZGENE
OMIM	134640	OMIM
PANTHER	PTHR11955	UniProtKB/Swiss-Prot
	PTHR11955:SF89	UniProtKB/Swiss-Prot
Pfam	Lipocalin	UniProtKB/Swiss-Prot
PharmGKB	PA27957	PharmGKB
PRINTS	FATTYACIDBP	UniProtKB/Swiss-Prot
PROSITE	FABP	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF50814	UniProtKB/Swiss-Prot
UniProt	FABPI_HUMAN	UniProtKB/Swiss-Prot, ENTREZGENE
	Q2NKJ1	ENTREZGENE
UniProt Secondary	Q2NKJ1	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-01-26	FABP2	fatty acid binding protein 2	FABP2	fatty acid binding protein 2, intestinal	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Manual Human Phenotype Annotations - RGD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Manual Human Phenotype Annotations - RGD