Symbol:
FABP2
Name:
fatty acid binding protein 2
RGD ID:
735842
HGNC Page
HGNC:3556
Description:
Enables long-chain fatty acid binding activity. Involved in intestinal lipid absorption. Predicted to be located in apical cortex and microvillus. Predicted to be active in cytosol and nucleus. Implicated in alcoholic liver cirrhosis; carotid stenosis; coronary artery disease; end stage renal disease; and obesity.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
FABPI; fatty acid binding protein 1; fatty acid binding protein 2, intestinal; fatty acid-binding protein 2; fatty acid-binding protein, intestinal; I-FABP; intestinal-type fatty acid-binding protein; MGC133132
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Fabp2 (fatty acid binding protein 2, intestinal) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Fabp2 (fatty acid binding protein 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Fabp2 (fatty acid binding protein 2) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
FABP2 (fatty acid binding protein 2) NCBI
Ortholog
Canis lupus familiaris (dog):
FABP2 (fatty acid binding protein 2) HGNC
HomoloGene, Inparanoid, NCBI, OMA, OrthoDB
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fabp2 (fatty acid binding protein 2) NCBI
Ortholog
Sus scrofa (pig):
FABP2 (fatty acid binding protein 2) HGNC
Ensembl, Inparanoid, NCBI, OrthoDB
Chlorocebus sabaeus (green monkey):
FABP2 (fatty acid binding protein 2) NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Fabp2 (fatty acid binding protein 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Fabp2 (fatty acid binding protein 2, intestinal)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fabp2 (fatty acid binding protein 2, intestinal)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Xenopus tropicalis (tropical clawed frog):
fabp2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
fabp2.L
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
fabp2.S
Alliance
DIOPT (Xenbase)
Allele / Splice:
See ClinVar data
Is Marker For:
QTLs:
BW127_H
Candidate Gene For:
BW441_H
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 119,317,250 - 119,322,138 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 119,317,250 - 119,322,138 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 120,238,405 - 120,243,293 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 120,457,853 - 120,462,766 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 120,596,008 - 120,600,921 NCBI Celera 4 117,600,001 - 117,604,911 (-) NCBI Celera Cytogenetic Map 4 q26 NCBI HuRef 4 115,960,235 - 115,965,143 (-) NCBI HuRef CHM1_1 4 120,214,972 - 120,219,883 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 122,622,352 - 122,627,246 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
FABP2 Human alcoholic liver cirrhosis onset IAGP 1578455 DNA:polymorphism:CDS:amino acid A54T, homozygosity of the T allele associated with later onset RGD FABP2 Human carotid stenosis IAGP 1582392 RGD FABP2 Human coronary artery disease IAGP 1626412 DNA:SNP:CDS:2445G>A, amino acid A54T, associated with Diabetes Mellitus, Type 2 (MeSH:D003924) in women RGD FABP2 Human Diabetic Nephropathies IAGP 1578457 DNA:polymorphism:CDS:amino acid A54T, in a Brazilian population RGD FABP2 Human end stage renal disease IAGP 1578457 DNA:polymorphism:CDS:amino acid A54T, associated with Diabetes Mellitus, Type 2 (MeSH:D003924) RGD FABP2 Human Experimental Diabetes Mellitus treatment ISO RGD:2591 598130069 RGD FABP2 Human Hypertriglyceridemia IAGP 1626401 DNA:polymorphism:CDS:amino acid A54T, in a normal glucose tolerant population from urban south India RGD FABP2 Human Hypertriglyceridemia IAGP 1300313 associated with Diabetes Mellitus, Type 2;DNA:missense mutation:cds:p.A54T (human) RGD FABP2 Human Insulin Resistance IAGP 1578456 DNA:polymorphism:CDS:amino acid A54T, in healthy, moderately overweight subjects in Baton Rouge RGD FABP2 Human Insulin Resistance no_association IAGP 1626407 DNA:polymorphism:CDS:amino acid A54T, in Chilean Aymara and Mapuche ethnic groups RGD FABP2 Human Insulin Resistance IAGP 1300314 DNA:SNP:CDS:p.A54T (human) RGD FABP2 Human Insulin Resistance IAGP 1626400 DNA:polymorphism:CDS:p.A54T (human) RGD FABP2 Human Metabolic Syndrome IAGP 1626401 DNA:polymorphism:CDS:amino acid A54T, in a normal glucose tolerant population from urban south India RGD FABP2 Human obesity no_association IAGP 1626407 DNA:polymorphism:CDS:amino acid A54T, in Chilean Aymara and Mapuche ethnic groups RGD FABP2 Human obesity IAGP 1626400 DNA:polymorphism:CDS:p.A54T (human) RGD FABP2 Human obesity onset IAGP 1578458 Early onset of obesity and resistance to reducing visceral white adipose tissue; DNA:polymorphism:CDS:amino acid more ... RGD FABP2 Human Stroke IAGP 1300312 DNA:missense mutation:cds:p.A54T (human) RGD FABP2 Human type 2 diabetes mellitus no_association IAGP 1626401 DNA:polymorphism:CDS:amino acid A54T, in a population from urban south India RGD
Only show annotations with direct experimental evidence (0 objects hidden)
FABP2 Human (1->4)-beta-D-glucan multiple interactions ISO RGD:10564 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of FABP2 mRNA CTD PMID:36331819 FABP2 Human 1,2-dimethylhydrazine decreases expression ISO RGD:10564 6480464 1,2-Dimethylhydrazine results in decreased expression of FABP2 mRNA CTD PMID:22206623 FABP2 Human 1-naphthyl isothiocyanate increases expression ISO RGD:2591 6480464 1-Naphthylisothiocyanate results in increased expression of FABP2 mRNA CTD PMID:25380136|PMID:30723492 FABP2 Human 17beta-estradiol increases expression ISO RGD:2591 6480464 Estradiol results in increased expression of FABP2 mRNA CTD PMID:32145629 FABP2 Human 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO RGD:2591 6480464 2,2',4,4'-tetrabromodiphenyl ether results in increased expression of FABP2 mRNA CTD PMID:27291303 FABP2 Human 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RGD:10564 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of FABP2 mRNA CTD PMID:38040069 FABP2 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:10564 6480464 Tetrachlorodibenzodioxin results in increased expression of FABP2 mRNA CTD PMID:19770486 FABP2 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:10564 6480464 Tetrachlorodibenzodioxin results in decreased expression of FABP2 mRNA CTD PMID:28238261 FABP2 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:10564 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression more ... CTD PMID:25975270 FABP2 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:10564 6480464 Tetrachlorodibenzodioxin affects the expression of FABP2 mRNA CTD PMID:21570461 FABP2 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:2591 6480464 Tetrachlorodibenzodioxin results in increased expression of FABP2 mRNA CTD PMID:21215274 FABP2 Human 2,4,6-trinitrobenzenesulfonic acid decreases expression ISO RGD:10564 6480464 Trinitrobenzenesulfonic Acid results in decreased expression of FABP2 mRNA CTD PMID:17982090 FABP2 Human 2,4,6-trinitrotoluene affects expression ISO RGD:2591 6480464 Trinitrotoluene affects the expression of FABP2 mRNA CTD PMID:21346803 FABP2 Human 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:10564 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of FABP2 mRNA CTD PMID:38648751 FABP2 Human 2,4-dinitrotoluene affects expression ISO RGD:2591 6480464 2,4-dinitrotoluene affects the expression of FABP2 mRNA CTD PMID:21346803 FABP2 Human 2,4-dinitrotoluene decreases expression ISO RGD:10564 6480464 2,4-dinitrotoluene results in decreased expression of FABP2 mRNA CTD PMID:24893713 FABP2 Human 2-palmitoylglycerol increases expression EXP 6480464 2-palmitoylglycerol results in increased expression of FABP2 mRNA CTD PMID:37199045 FABP2 Human 4,4'-diaminodiphenylmethane increases expression ISO RGD:2591 6480464 4,4'-diaminodiphenylmethane results in increased expression of FABP2 mRNA CTD PMID:25380136|PMID:30723492 FABP2 Human 4,4'-diaminodiphenylmethane decreases expression ISO RGD:10564 6480464 4,4'-diaminodiphenylmethane results in decreased expression of FABP2 mRNA CTD PMID:18648102 FABP2 Human 4,4'-sulfonyldiphenol affects expression ISO RGD:10564 6480464 bisphenol S affects the expression of FABP2 mRNA CTD PMID:39298647 FABP2 Human aflatoxin M1 decreases expression EXP 6480464 Aflatoxin M1 results in decreased expression of FABP2 mRNA CTD PMID:30928695 FABP2 Human ammonium chloride affects expression ISO RGD:2591 6480464 Ammonium Chloride affects the expression of FABP2 mRNA CTD PMID:16483693 FABP2 Human benzo[a]pyrene increases expression ISO RGD:10564 6480464 Benzo(a)pyrene results in increased expression of FABP2 mRNA CTD PMID:19770486|PMID:21715664 FABP2 Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of FABP2 5' UTR; Benzo(a)pyrene results in increased methylation of more ... CTD PMID:27901495 FABP2 Human bexarotene multiple interactions ISO RGD:2591 6480464 [Tamoxifen co-treated with bexarotene] results in decreased expression of FABP2 mRNA CTD PMID:17630414 FABP2 Human bexarotene decreases expression ISO RGD:2591 6480464 bexarotene results in decreased expression of FABP2 mRNA CTD PMID:17630414 FABP2 Human bezafibrate increases expression ISO RGD:10564 6480464 Bezafibrate results in increased expression of FABP2 mRNA CTD PMID:17118139 FABP2 Human bis(2-ethylhexyl) phthalate increases expression ISO RGD:10564 6480464 Diethylhexyl Phthalate results in increased expression of FABP2 mRNA CTD PMID:19245819|PMID:19850644 FABP2 Human bis(2-ethylhexyl) phthalate decreases expression ISO RGD:10564 6480464 Diethylhexyl Phthalate results in decreased expression of FABP2 mRNA CTD PMID:28085963 FABP2 Human captan increases expression ISO RGD:10564 6480464 Captan results in increased expression of FABP2 mRNA CTD PMID:31558096 FABP2 Human carbon nanotube increases expression ISO RGD:10564 6480464 Nanotubes, Carbon analog results in increased expression of FABP2 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25620056 FABP2 Human clofibrate increases expression ISO RGD:10564 6480464 Clofibrate results in increased expression of FABP2 mRNA CTD PMID:17585979 FABP2 Human copper(II) sulfate decreases expression EXP 6480464 Copper Sulfate results in decreased expression of FABP2 mRNA CTD PMID:19549813 FABP2 Human corn oil affects expression ISO RGD:2591 6480464 Corn Oil affects the expression of FABP2 mRNA CTD PMID:16360708 FABP2 Human cyclosporin A decreases expression ISO RGD:10564 6480464 Cyclosporine results in decreased expression of FABP2 mRNA CTD PMID:19770486 FABP2 Human decabromodiphenyl ether increases expression ISO RGD:2591 6480464 decabromobiphenyl ether results in increased expression of FABP2 mRNA CTD PMID:23640034 FABP2 Human dichlorine multiple interactions ISO RGD:2591 6480464 [Ozone co-treated with Chlorine] results in increased expression of FABP2 mRNA CTD PMID:18636392 FABP2 Human diclofenac decreases expression ISO RGD:2591 6480464 Diclofenac results in decreased expression of FABP2 mRNA CTD PMID:19022234 FABP2 Human diclofenac decreases expression ISO RGD:10564 6480464 Diclofenac results in decreased expression of FABP2 mRNA CTD PMID:26934552 FABP2 Human difenoconazole decreases expression ISO RGD:10564 6480464 difenoconazole results in decreased expression of FABP2 mRNA CTD PMID:34425431 FABP2 Human endosulfan decreases expression ISO RGD:2591 6480464 Endosulfan results in decreased expression of FABP2 mRNA CTD PMID:29391264 FABP2 Human epoxiconazole increases expression ISO RGD:10564 6480464 epoxiconazole results in increased expression of FABP2 mRNA CTD PMID:35436446 FABP2 Human ethanol multiple interactions ISO RGD:2591 6480464 [Fish Oils co-treated with Ethanol] results in increased expression of FABP2 mRNA CTD PMID:17347304 FABP2 Human fenofibrate increases expression ISO RGD:10564 6480464 Fenofibrate results in increased expression of FABP2 mRNA CTD PMID:17118139 FABP2 Human ferroheme b multiple interactions ISO RGD:2591 6480464 [Heme co-treated with Calcium, Dietary] results in increased expression of FABP2 mRNA CTD PMID:15539406 FABP2 Human ferroheme b increases expression ISO RGD:2591 6480464 Heme results in increased expression of FABP2 mRNA CTD PMID:15539406 FABP2 Human folpet increases expression ISO RGD:10564 6480464 folpet results in increased expression of FABP2 mRNA CTD PMID:31558096 FABP2 Human furan increases expression ISO RGD:2591 6480464 furan results in increased expression of FABP2 mRNA CTD PMID:25539665|PMID:26194646 FABP2 Human heme b increases expression ISO RGD:2591 6480464 Heme results in increased expression of FABP2 mRNA CTD PMID:15539406 FABP2 Human heme b multiple interactions ISO RGD:2591 6480464 [Heme co-treated with Calcium, Dietary] results in increased expression of FABP2 mRNA CTD PMID:15539406 FABP2 Human inulin multiple interactions ISO RGD:10564 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of FABP2 mRNA CTD PMID:36331819 FABP2 Human iron atom increases expression ISO RGD:2591 6480464 Iron deficiency results in increased expression of FABP2 mRNA CTD PMID:19821111 FABP2 Human iron(0) increases expression ISO RGD:2591 6480464 Iron deficiency results in increased expression of FABP2 mRNA CTD PMID:19821111 FABP2 Human metformin decreases expression ISO RGD:2591 6480464 Metformin results in decreased expression of FABP2 mRNA CTD PMID:19022234 FABP2 Human microcystin-LR increases expression ISO RGD:10564 6480464 cyanoginosin LR results in increased expression of FABP2 protein CTD PMID:26984711 FABP2 Human N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of FABP2 mRNA CTD PMID:24767308 FABP2 Human N-nitrosodiethylamine multiple interactions ISO RGD:2591 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of FABP2 mRNA CTD PMID:28943392 FABP2 Human N-nitrosodimethylamine increases expression ISO RGD:2591 6480464 Dimethylnitrosamine results in increased expression of FABP2 mRNA CTD PMID:25380136 FABP2 Human nordihydroguaiaretic acid increases expression ISO RGD:2591 329955565 NDGA increases expression of mRNA in liver of high fructose fed rats RGD FABP2 Human oleic acid affects binding ISO RGD:2591 6480464 FABP2 protein modified form binds to Oleic Acid CTD PMID:16137630 FABP2 Human ozone multiple interactions ISO RGD:2591 6480464 [Ozone co-treated with Chlorine] results in increased expression of FABP2 mRNA CTD PMID:18636392 FABP2 Human paracetamol affects expression ISO RGD:10564 6480464 Acetaminophen affects the expression of FABP2 mRNA CTD PMID:17562736 FABP2 Human perfluorohexanesulfonic acid decreases expression ISO RGD:10564 6480464 perfluorohexanesulfonic acid results in decreased expression of FABP2 mRNA; perfluorohexanesulfonic acid results in decreased expression more ... CTD PMID:21705711|PMID:37315490 FABP2 Human perfluorohexanesulfonic acid increases expression ISO RGD:10564 6480464 perfluorohexanesulfonic acid results in increased expression of FABP2 mRNA CTD PMID:37315490 FABP2 Human perfluorooctane-1-sulfonic acid decreases expression ISO RGD:10564 6480464 perfluorooctane sulfonic acid results in decreased expression of FABP2 mRNA CTD PMID:21705711 FABP2 Human perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:10564 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of FABP2 mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 FABP2 Human perfluorooctanoic acid increases expression ISO RGD:10564 6480464 perfluorooctanoic acid results in increased expression of FABP2 mRNA CTD PMID:17681415|PMID:18467677 FABP2 Human perfluorooctanoic acid decreases expression ISO RGD:10564 6480464 perfluorooctanoic acid results in decreased expression of FABP2 mRNA CTD PMID:30657992 FABP2 Human perfluorooctanoic acid multiple interactions ISO RGD:10564 6480464 PPARA protein promotes the reaction [perfluorooctanoic acid results in increased expression of FABP2 mRNA] CTD PMID:18467677 FABP2 Human phenobarbital increases expression ISO RGD:2591 6480464 Phenobarbital results in increased expression of FABP2 mRNA CTD PMID:19162173 FABP2 Human phenobarbital affects expression ISO RGD:10564 6480464 Phenobarbital affects the expression of FABP2 mRNA CTD PMID:23091169 FABP2 Human phenobarbital decreases expression ISO RGD:10564 6480464 Phenobarbital results in decreased expression of FABP2 mRNA CTD PMID:25270620 FABP2 Human pirinixic acid multiple interactions ISO RGD:10564 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:18467677|PMID:19710929|PMID:20059764 FABP2 Human pirinixic acid increases expression ISO RGD:10564 6480464 pirinixic acid results in increased expression of FABP2 mRNA CTD PMID:16221962|PMID:16357043|PMID:18301758|PMID:18467677|PMID:20059764|PMID:20813756|PMID:23811191 FABP2 Human potassium dichromate increases expression ISO RGD:10564 6480464 Potassium Dichromate results in increased expression of FABP2 mRNA CTD PMID:23608068 FABP2 Human pravastatin decreases expression ISO RGD:10564 6480464 Pravastatin results in decreased expression of FABP2 mRNA CTD PMID:27225895 FABP2 Human pravastatin increases expression ISO RGD:2591 6480464 Pravastatin results in increased expression of FABP2 mRNA CTD PMID:27225895 FABP2 Human pregnenolone 16alpha-carbonitrile increases expression ISO RGD:2591 6480464 Pregnenolone Carbonitrile results in increased expression of FABP2 mRNA CTD PMID:19162173 FABP2 Human propamocarb decreases expression ISO RGD:10564 6480464 propamocarb results in decreased expression of FABP2 mRNA CTD PMID:29137890 FABP2 Human propiconazole decreases expression ISO RGD:10564 6480464 propiconazole results in decreased expression of FABP2 mRNA CTD PMID:21278054 FABP2 Human rifaximin multiple interactions EXP 6480464 [NR1I2 results in increased susceptibility to rifaximin] which results in increased expression of FABP2 protein CTD PMID:22790967 FABP2 Human rotenone decreases expression ISO RGD:2591 6480464 Rotenone results in decreased expression of FABP2 mRNA CTD PMID:28374803 FABP2 Human sodium dichromate increases expression ISO RGD:2591 6480464 sodium bichromate results in increased expression of FABP2 mRNA CTD PMID:25993096 FABP2 Human tacrolimus hydrate decreases expression ISO RGD:10564 6480464 Tacrolimus results in decreased expression of FABP2 mRNA CTD PMID:25270620 FABP2 Human tamoxifen multiple interactions ISO RGD:2591 6480464 [Tamoxifen co-treated with bexarotene] results in decreased expression of FABP2 mRNA CTD PMID:17630414 FABP2 Human tamoxifen decreases expression ISO RGD:2591 6480464 Tamoxifen results in decreased expression of FABP2 mRNA CTD PMID:17630414 FABP2 Human tetrachloromethane decreases expression ISO RGD:2591 6480464 Carbon Tetrachloride results in decreased expression of FABP2 mRNA CTD PMID:31150632 FABP2 Human tetrachloromethane decreases expression ISO RGD:10564 6480464 Carbon Tetrachloride results in decreased expression of FABP2 mRNA CTD PMID:31919559 FABP2 Human thioacetamide increases expression ISO RGD:2591 6480464 Thioacetamide results in increased expression of FABP2 mRNA CTD PMID:23411599|PMID:34492290 FABP2 Human thioacetamide multiple interactions ISO RGD:2591 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of FABP2 mRNA CTD PMID:28943392 FABP2 Human troglitazone increases expression ISO RGD:2591 6480464 troglitazone results in increased expression of FABP2 mRNA CTD PMID:19022234 FABP2 Human valproic acid affects response to substance EXP 6480464 FABP2 gene SNP affects the susceptibility to Valproic Acid CTD PMID:17310796 FABP2 Human valproic acid decreases methylation EXP 6480464 Valproic Acid results in decreased methylation of FABP2 gene CTD PMID:29501571 FABP2 Human vinclozolin decreases expression ISO RGD:2591 6480464 vinclozolin results in decreased expression of FABP2 mRNA CTD PMID:23034163 FABP2 Human zinc atom increases expression ISO RGD:2591 6480464 Zinc deficiency results in increased expression of FABP2 mRNA CTD PMID:11717422 FABP2 Human zinc(0) increases expression ISO RGD:2591 6480464 Zinc deficiency results in increased expression of FABP2 mRNA CTD PMID:11717422
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2,4,6-trinitrotoluene (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (ISO) 2-palmitoylglycerol (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) aflatoxin M1 (EXP) ammonium chloride (ISO) benzo[a]pyrene (EXP,ISO) bexarotene (ISO) bezafibrate (ISO) bis(2-ethylhexyl) phthalate (ISO) captan (ISO) carbon nanotube (ISO) clofibrate (ISO) copper(II) sulfate (EXP) corn oil (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) dichlorine (ISO) diclofenac (ISO) difenoconazole (ISO) endosulfan (ISO) epoxiconazole (ISO) ethanol (ISO) fenofibrate (ISO) ferroheme b (ISO) folpet (ISO) furan (ISO) heme b (ISO) inulin (ISO) iron atom (ISO) iron(0) (ISO) metformin (ISO) microcystin-LR (ISO) N-methyl-4-phenylpyridinium (EXP) N-nitrosodiethylamine (ISO) N-nitrosodimethylamine (ISO) nordihydroguaiaretic acid (ISO) oleic acid (ISO) ozone (ISO) paracetamol (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) potassium dichromate (ISO) pravastatin (ISO) pregnenolone 16alpha-carbonitrile (ISO) propamocarb (ISO) propiconazole (ISO) rifaximin (EXP) rotenone (ISO) sodium dichromate (ISO) tacrolimus hydrate (ISO) tamoxifen (ISO) tetrachloromethane (ISO) thioacetamide (ISO) troglitazone (ISO) valproic acid (EXP) vinclozolin (ISO) zinc atom (ISO) zinc(0) (ISO)
1.
Intestinal FABP2 A54T polymorphism: association with insulin resistance and obesity in women.
Albala C, etal., Obes Res. 2004 Feb;12(2):340-5.
2.
An amino acid substitution in the human intestinal fatty acid binding protein is associated with increased fatty acid binding, increased fat oxidation, and insulin resistance.
Baier LJ, etal., J Clin Invest 1995 Mar;95(3):1281-7.
3.
The fatty acid-binding protein-2 A54T polymorphism is associated with renal disease in patients with type 2 diabetes.
Canani LH, etal., Diabetes. 2005 Nov;54(11):3326-30.
4.
The T 54 allele of the intestinal fatty acid-binding protein 2 is associated with a parental history of stroke.
Carlsson M, etal., J Clin Endocrinol Metab 2000 Aug;85(8):2801-4.
5.
Codon-54 polymorphism of the fatty acid-binding protein 2 gene is associated with elevation of fasting and postprandial triglyceride in type 2 diabetes.
Georgopoulos A, etal., J Clin Endocrinol Metab 2000 Sep;85(9):3155-60.
6.
GOAs Human GO annotations
GOA_HUMAN data from the GO Consortium
7.
Variation of the fatty acid binding protein 2 gene is not associated with obesity and insulin resistance in Japanese subjects.
Hayakawa T, etal., Metabolism. 1999 May;48(5):655-7.
8.
Effects of intestinal fatty acid-binding protein gene Ala54Thr polymorphism and beta3-adrenergic receptor gene Trp64Arg polymorphism on insulin resistance and fasting plasma glucose in young to older Japanese men.
Ishii T, etal., Metabolism. 2001 Nov;50(11):1301-7.
9.
Comparison of the acute response to meals enriched with cis- or trans-fatty acids on glucose and lipids in overweight individuals with differing FABP2 genotypes.
Lefevre M, etal., Metabolism. 2005 Dec;54(12):1652-8.
10.
Antidiabetic, Lipid Normalizing, and Nephroprotective Actions of the Strawberry: A Potent Supplementary Fruit.
Mandave P, etal., Int J Mol Sci. 2017 Jan 11;18(1):124. doi: 10.3390/ijms18010124.
11.
Lack of association between the fatty acid binding protein 2 (FABP2) polymorphism with obesity and insulin resistance in two aboriginal populations from Chile.
Perez-Bravo F, etal., Acta Diabetol. 2006 Dec;43(4):93-8.
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
The role of FABP2 gene polymorphism in alcoholic cirrhosis.
Salguero ML, etal., Hepatol Res. 2005 Nov 8;.
15.
Thr54 allele of the FABP2 gene affects resting metabolic rate and visceral obesity.
Takakura Y, etal., Diabetes Res Clin Pract. 2005 Jan;67(1):36-42.
16.
Thr54 allele carriers of the Ala54Thr variant of FABP2 gene have associations with metabolic syndrome and hypertriglyceridemia in urban South Indians.
Vimaleswaran KS, etal., Metabolism. 2006 Sep;55(9):1222-6.
17.
Genetic variation of the intestinal fatty acid-binding protein 2 gene in carotid atherosclerosis.
Wanby P, etal., Vasc Med. 2005 May;10(2):103-8.
18.
Genetic risk for coronary artery disease in individuals with or without type 2 diabetes.
Yamada Y, etal., Mol Genet Metab. 2004 Apr;81(4):282-90.
19.
Effect of Creosote Bush-Derived NDGA on Expression of Genes Involved in Lipid Metabolism in Liver of High-Fructose Fed Rats: Relevance to NDGA Amelioration of Hypertriglyceridemia and Hepatic Steatosis.
Zhang H, etal., PLoS One. 2015 Sep 22;10(9):e0138203. doi: 10.1371/journal.pone.0138203. eCollection 2015.
FABP2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 119,317,250 - 119,322,138 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 119,317,250 - 119,322,138 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 120,238,405 - 120,243,293 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 120,457,853 - 120,462,766 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 120,596,008 - 120,600,921 NCBI Celera 4 117,600,001 - 117,604,911 (-) NCBI Celera Cytogenetic Map 4 q26 NCBI HuRef 4 115,960,235 - 115,965,143 (-) NCBI HuRef CHM1_1 4 120,214,972 - 120,219,883 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 122,622,352 - 122,627,246 (-) NCBI T2T-CHM13v2.0
Fabp2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 122,688,721 - 122,693,155 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 122,688,721 - 122,693,155 (+) Ensembl GRCm39 Ensembl GRCm38 3 122,895,072 - 122,899,506 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 122,895,072 - 122,899,506 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 122,598,310 - 122,602,424 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 122,887,414 - 122,891,528 (+) NCBI MGSCv36 mm8 Celera 3 129,305,754 - 129,309,868 (+) NCBI Celera Cytogenetic Map 3 G1 NCBI cM Map 3 53.74 NCBI
Fabp2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 213,724,629 - 213,728,686 (+) NCBI GRCr8 mRatBN7.2 2 211,040,032 - 211,044,089 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 211,040,032 - 211,044,089 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 218,717,756 - 218,721,725 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 216,625,543 - 216,629,512 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 211,471,755 - 211,475,828 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 227,080,912 - 227,083,654 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 227,080,924 - 227,083,501 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 246,442,292 - 246,445,034 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 219,591,502 - 219,605,097 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 219,554,563 - 219,568,159 (+) NCBI Celera 2 203,465,826 - 203,473,400 (+) NCBI Celera RH 3.4 Map 2 1537.1 RGD Cytogenetic Map 2 q42 NCBI
Fabp2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955428 20,930,479 - 20,933,950 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955428 20,930,512 - 20,933,950 (+) NCBI ChiLan1.0 ChiLan1.0
FABP2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 117,095,776 - 117,098,841 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 117,388,095 - 117,395,765 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 111,505,269 - 111,510,197 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 122,055,544 - 122,060,461 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 122,055,544 - 122,060,461 (-) Ensembl panpan1.1 panPan2
FABP2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 32 38,244,065 - 38,248,093 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 ROS_Cfam_1.0 32 38,465,352 - 38,497,153 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 32 38,465,346 - 38,492,684 (-) Ensembl ROS_Cfam_1.0 Ensembl
Fabp2
FABP2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 104,464,342 - 104,470,480 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 104,464,342 - 104,468,059 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 112,120,922 - 112,124,639 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FABP2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 66,797,832 - 66,803,459 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 66,798,990 - 66,802,738 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 45,658,385 - 45,663,315 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 752 Count of miRNA genes: 448 Interacting mature miRNAs: 478 Transcripts: ENST00000274024 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1643256 BW127_H Body Weight QTL 127 (human) 1.31 0.007 Body weight body mass index 4 106319694 132319694 Human 597335003 GWAS1431077_H pulmonary embolism QTL GWAS1431077 (human) 8e-17 pulmonary embolism 4 119320747 119320748 Human 597164218 GWAS1260292_H androsterone sulfate measurement QTL GWAS1260292 (human) 0.000004 androsterone sulfate measurement 4 119318723 119318724 Human 597294095 GWAS1390169_H cGMP-specific 3',5'-cyclic phosphodiesterase measurement QTL GWAS1390169 (human) 4e-12 cGMP-specific 3',5'-cyclic phosphodiesterase measurement 4 119320694 119320695 Human 597061374 GWAS1157448_H metabolic syndrome QTL GWAS1157448 (human) 4e-08 metabolic syndrome 4 119318723 119318724 Human 596961464 GWAS1080983_H metabolic syndrome QTL GWAS1080983 (human) 4e-08 metabolic syndrome 4 119318723 119318724 Human
SHGC4-110
Human Assembly Chr Position (strand) Source JBrowse GRCh37 4 120,240,211 - 120,240,619 UniSTS GRCh37 Build 36 4 120,459,659 - 120,460,067 RGD NCBI36 Celera 4 117,601,807 - 117,602,215 RGD Cytogenetic Map 4 q28-q31 UniSTS HuRef 4 115,962,041 - 115,962,449 UniSTS TNG Radiation Hybrid Map 4 73768.0 UniSTS
GDB:178665
Human Assembly Chr Position (strand) Source JBrowse GRCh37 4 120,240,775 - 120,240,878 UniSTS GRCh37 Build 36 4 120,460,223 - 120,460,326 RGD NCBI36 Celera 4 117,602,371 - 117,602,477 RGD Cytogenetic Map 4 q28-q31 UniSTS HuRef 4 115,962,605 - 115,962,717 UniSTS
SHGC-145405
Human Assembly Chr Position (strand) Source JBrowse GRCh37 4 120,242,866 - 120,243,175 UniSTS GRCh37 Build 36 4 120,462,314 - 120,462,623 RGD NCBI36 Celera 4 117,604,461 - 117,604,770 RGD Cytogenetic Map 4 q28-q31 UniSTS HuRef 4 115,964,693 - 115,965,002 UniSTS TNG Radiation Hybrid Map 10 42794.0 UniSTS
PMC31346P1
Human Assembly Chr Position (strand) Source JBrowse GRCh37 4 120,241,733 - 120,242,108 UniSTS GRCh37 Build 36 4 120,461,181 - 120,461,556 RGD NCBI36 Celera 4 117,603,328 - 117,603,703 RGD Cytogenetic Map 4 q28-q31 UniSTS HuRef 4 115,963,560 - 115,963,935 UniSTS
FABP2_200
Human Assembly Chr Position (strand) Source JBrowse GRCh37 4 120,238,315 - 120,239,210 UniSTS GRCh37 Build 36 4 120,457,763 - 120,458,658 RGD NCBI36 Celera 4 117,599,911 - 117,600,806 RGD HuRef 4 115,960,145 - 115,961,040 UniSTS
SHGC-59292
Human Assembly Chr Position (strand) Source JBrowse GRCh37 4 120,240,031 - 120,240,183 UniSTS GRCh37 Build 36 4 120,459,479 - 120,459,631 RGD NCBI36 Celera 4 117,601,627 - 117,601,779 RGD Cytogenetic Map 4 q28-q31 UniSTS HuRef 4 115,961,861 - 115,962,013 UniSTS GeneMap99-GB4 RH Map 4 546.46 UniSTS Whitehead-RH Map 4 597.7 UniSTS NCBI RH Map 4 1251.6 UniSTS
SHGC4-8
Human Assembly Chr Position (strand) Source JBrowse GRCh37 4 120,240,730 - 120,240,934 UniSTS GRCh37 Build 36 4 120,460,178 - 120,460,382 RGD NCBI36 Celera 4 117,602,326 - 117,602,533 RGD Cytogenetic Map 4 q28-q31 UniSTS HuRef 4 115,962,560 - 115,962,773 UniSTS Stanford-G3 RH Map 4 6747.0 UniSTS NCBI RH Map 4 1228.1 UniSTS GeneMap99-G3 RH Map 4 6693.0 UniSTS
SHGC-59542
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 4 q28-q31 UniSTS HuRef 4 115,962,852 - 115,963,027 UniSTS GeneMap99-GB4 RH Map 4 556.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
615
1577
1536
1403
1880
1004
1094
1
310
827
219
723
4303
3317
4
1607
382
1047
744
93
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000274024 ⟹ ENSP00000274024
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 119,317,250 - 119,322,138 (-) Ensembl
RefSeq Acc Id:
NM_000134 ⟹ NP_000125
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 4 119,317,250 - 119,322,138 (-) NCBI GRCh37 4 120,238,405 - 120,243,316 (-) ENTREZGENE Build 36 4 120,457,853 - 120,462,766 (-) NCBI Archive HuRef 4 115,960,235 - 115,965,143 (-) ENTREZGENE CHM1_1 4 120,214,972 - 120,219,883 (-) NCBI T2T-CHM13v2.0 4 122,622,352 - 122,627,246 (-) NCBI
Sequence:
ATCTCTAGCTGCCTAGAGGCTGACTCAACTGAAATCATGGCGTTTGACAGCACTTGGAAGGTAGACCGGAGTGAAAACTATGACAAGTTCATGGAAAAAATGGGTGTTAATATAGTGAAAAGGAAGCT
hide sequence
RefSeq Acc Id:
NP_000125 ⟸ NM_000134
- UniProtKB:
Q2NKJ1 (UniProtKB/Swiss-Prot), P12104 (UniProtKB/Swiss-Prot)
- Sequence:
MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSTFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRI
hide sequence
Ensembl Acc Id:
ENSP00000274024 ⟸ ENST00000274024
RGD ID: 6868366 Promoter ID: EPDNEW_H7348 Type: multiple initiation site Name: FABP2_1 Description: fatty acid binding protein 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H7349 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 4 119,322,138 - 119,322,198 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-01-26
FABP2
fatty acid binding protein 2
FABP2
fatty acid binding protein 2, intestinal
Symbol and/or name change
5135510 APPROVED
