Symbol:
Bpgm
Name:
bisphosphoglycerate mutase
RGD ID:
735018
Description:
Predicted to enable bisphosphoglycerate mutase activity. Involved in erythrocyte development. Human ortholog(s) of this gene implicated in familial erythrocytosis 8. Orthologous to human BPGM (bisphosphoglycerate mutase); PARTICIPATES IN Fanconi syndrome pathway; fructose-1,6-bisphosphatase deficiency pathway; gluconeogenesis pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; acrylamide.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
2,3-bisphosphoglycerate mutase; Ab2-098; LOC296973
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
BPGM (bisphosphoglycerate mutase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Bpgm (2,3-bisphosphoglycerate mutase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Bpgm (bisphosphoglycerate mutase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
BPGM (bisphosphoglycerate mutase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
BPGM (bisphosphoglycerate mutase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Bpgm (bisphosphoglycerate mutase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
BPGM (bisphosphoglycerate mutase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
BPGM (bisphosphoglycerate mutase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Bpgm (bisphosphoglycerate mutase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Bpgm (2,3-bisphosphoglycerate mutase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
BPGM (bisphosphoglycerate mutase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
bpgm (2,3-bisphosphoglycerate mutase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
GPM2
Alliance
DIOPT (Ensembl Compara|OrthoFinder)
Saccharomyces cerevisiae (baker's yeast):
GPM3
Alliance
DIOPT (Ensembl Compara|OrthoFinder)
Xenopus tropicalis (tropical clawed frog):
bpgm
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 64,106,809 - 64,135,749 (+) NCBI GRCr8 mRatBN7.2 4 63,139,730 - 63,168,581 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 63,140,018 - 63,168,581 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 68,098,223 - 68,126,740 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 64,013,920 - 64,042,437 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 62,416,337 - 62,444,854 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 61,912,210 - 61,940,697 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 61,912,210 - 61,940,696 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 61,650,881 - 61,679,069 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 61,858,884 - 61,888,007 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 62,135,013 - 62,164,136 (+) NCBI Celera 4 58,192,196 - 58,220,785 (+) NCBI Celera Cytogenetic Map 4 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Bpgm Rat (-)-epigallocatechin 3-gallate decreases expression ISO BPGM (Homo sapiens) 6480464 epigallocatechin gallate results in decreased expression of BPGM mRNA CTD PMID:16084531 Bpgm Rat 1,2-dimethylhydrazine increases expression ISO Bpgm (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of BPGM mRNA CTD PMID:22206623 Bpgm Rat 1,2-dimethylhydrazine multiple interactions ISO Bpgm (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of BPGM mRNA] CTD PMID:22206623 Bpgm Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of BPGM mRNA CTD PMID:29097150 Bpgm Rat 17beta-estradiol multiple interactions ISO BPGM (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of BPGM mRNA CTD PMID:20660070 Bpgm Rat 17beta-estradiol increases expression ISO Bpgm (Mus musculus) 6480464 Estradiol results in increased expression of BPGM mRNA CTD PMID:39298647 Bpgm Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Bpgm (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of BPGM mRNA CTD PMID:19933214 Bpgm Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO BPGM (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of BPGM mRNA CTD PMID:23152189 Bpgm Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO BPGM (Homo sapiens) 6480464 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of BPGM mRNA] and alpha-naphthoflavone inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of BPGM mRNA] CTD PMID:23152189 Bpgm Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of BPGM mRNA CTD PMID:21215274 and PMID:33387578 Bpgm Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of BPGM mRNA] CTD PMID:21215274 Bpgm Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Bpgm (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of BPGM mRNA CTD PMID:25172293 Bpgm Rat 3-methylcholanthrene increases expression ISO Bpgm (Mus musculus) 6480464 Methylcholanthrene results in increased expression of BPGM mRNA CTD PMID:20713471 Bpgm Rat 4,4'-sulfonyldiphenol increases expression ISO BPGM (Homo sapiens) 6480464 bisphenol S results in increased expression of BPGM mRNA CTD PMID:31121516 Bpgm Rat 4,4'-sulfonyldiphenol increases expression ISO Bpgm (Mus musculus) 6480464 bisphenol S results in increased expression of BPGM mRNA CTD PMID:39298647 Bpgm Rat 4-hydroxyphenyl retinamide decreases expression ISO Bpgm (Mus musculus) 6480464 Fenretinide results in decreased expression of BPGM mRNA CTD PMID:28973697 Bpgm Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of BPGM mRNA CTD PMID:28959563 Bpgm Rat alpha-naphthoflavone multiple interactions ISO BPGM (Homo sapiens) 6480464 alpha-naphthoflavone inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of BPGM mRNA] CTD PMID:23152189 Bpgm Rat alpha-naphthoflavone increases expression ISO BPGM (Homo sapiens) 6480464 alpha-naphthoflavone results in increased expression of BPGM mRNA CTD PMID:23152189 Bpgm Rat antirheumatic drug increases expression ISO BPGM (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of BPGM mRNA CTD PMID:24449571 Bpgm Rat arsane multiple interactions ISO BPGM (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of BPGM mRNA CTD PMID:39836092 Bpgm Rat arsenic atom multiple interactions ISO BPGM (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of BPGM mRNA CTD PMID:39836092 Bpgm Rat arsenite(3-) multiple interactions ISO BPGM (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to BPGM mRNA] CTD PMID:32406909 Bpgm Rat benzo[a]pyrene decreases expression ISO Bpgm (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of BPGM mRNA CTD PMID:21569818 Bpgm Rat benzo[a]pyrene affects methylation ISO BPGM (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of BPGM promoter CTD PMID:27901495 Bpgm Rat benzo[a]pyrene decreases methylation ISO BPGM (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of BPGM 5' UTR CTD PMID:27901495 Bpgm Rat benzo[a]pyrene increases expression ISO Bpgm (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of BPGM mRNA CTD PMID:20713471 Bpgm Rat beta-naphthoflavone decreases expression ISO BPGM (Homo sapiens) 6480464 beta-Naphthoflavone results in decreased expression of BPGM mRNA CTD PMID:32858204 Bpgm Rat bis(2-ethylhexyl) phthalate decreases expression ISO Bpgm (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of BPGM mRNA CTD PMID:28085963 Bpgm Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of BPGM mRNA CTD PMID:31199487 Bpgm Rat bisphenol A decreases expression ISO Bpgm (Mus musculus) 6480464 bisphenol A results in decreased expression of BPGM mRNA CTD PMID:26063408 and PMID:33221593 Bpgm Rat bisphenol A increases methylation ISO BPGM (Homo sapiens) 6480464 bisphenol A results in increased methylation of BPGM gene CTD PMID:31601247 Bpgm Rat bisphenol A decreases expression ISO BPGM (Homo sapiens) 6480464 bisphenol A results in decreased expression of BPGM protein CTD PMID:31675489 Bpgm Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of BPGM mRNA CTD PMID:25181051 more ... Bpgm Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of BPGM mRNA CTD PMID:24136188 Bpgm Rat Butylbenzyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of BPGM mRNA CTD PMID:31199487 Bpgm Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of BPGM mRNA CTD PMID:19167457 Bpgm Rat cadmium atom multiple interactions ISO Bpgm (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of BPGM mRNA CTD PMID:37325564 Bpgm Rat cadmium dichloride multiple interactions ISO Bpgm (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of BPGM mRNA CTD PMID:37325564 Bpgm Rat captan increases expression ISO Bpgm (Mus musculus) 6480464 Captan results in increased expression of BPGM mRNA CTD PMID:31558096 Bpgm Rat carbon nanotube decreases expression ISO Bpgm (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of BPGM mRNA CTD PMID:25554681 Bpgm Rat CGP 52608 multiple interactions ISO BPGM (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to BPGM gene] CTD PMID:28238834 Bpgm Rat chlordecone increases expression ISO Bpgm (Mus musculus) 6480464 Chlordecone results in increased expression of BPGM mRNA CTD PMID:33711761 Bpgm Rat chromium(6+) multiple interactions ISO BPGM (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of BPGM mRNA CTD PMID:38479592 Bpgm Rat copper(II) sulfate increases expression ISO BPGM (Homo sapiens) 6480464 Copper Sulfate results in increased expression of BPGM mRNA CTD PMID:19549813 Bpgm Rat daidzein multiple interactions ISO BPGM (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] affects the expression of BPGM mRNA CTD PMID:27424125 Bpgm Rat daidzein 7-O-beta-D-glucoside multiple interactions ISO BPGM (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] affects the expression of BPGM mRNA CTD PMID:27424125 Bpgm Rat decabromodiphenyl ether increases expression ISO BPGM (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of BPGM protein CTD PMID:31675489 Bpgm Rat dibutyl phthalate increases expression ISO Bpgm (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of BPGM mRNA CTD PMID:21266533 Bpgm Rat dibutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of BPGM mRNA CTD PMID:31199487 Bpgm Rat dicrotophos decreases expression ISO BPGM (Homo sapiens) 6480464 dicrotophos results in decreased expression of BPGM mRNA CTD PMID:28302478 Bpgm Rat diethyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of BPGM mRNA CTD PMID:31199487 Bpgm Rat diisobutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of BPGM mRNA CTD PMID:31199487 Bpgm Rat diisononyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of BPGM mRNA CTD PMID:31199487 Bpgm Rat dinophysistoxin 1 increases expression ISO BPGM (Homo sapiens) 6480464 dinophysistoxin 1 results in increased expression of BPGM mRNA CTD PMID:28939011 Bpgm Rat dioxygen multiple interactions ISO Bpgm (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of BPGM mRNA CTD PMID:30529165 Bpgm Rat doxorubicin affects expression ISO Bpgm (Mus musculus) 6480464 Doxorubicin affects the expression of BPGM mRNA CTD PMID:29653124 Bpgm Rat fenvalerate decreases expression EXP 6480464 fenvalerate results in decreased expression of BPGM protein CTD PMID:33656234 Bpgm Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of BPGM mRNA CTD PMID:24136188 Bpgm Rat folic acid multiple interactions ISO Bpgm (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of BPGM mRNA] CTD PMID:22206623 Bpgm Rat formaldehyde increases expression ISO BPGM (Homo sapiens) 6480464 Formaldehyde results in increased expression of BPGM mRNA CTD PMID:23649840 Bpgm Rat genistein multiple interactions ISO BPGM (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] affects the expression of BPGM mRNA CTD PMID:27424125 Bpgm Rat genistein 7-O-beta-D-glucoside multiple interactions ISO BPGM (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] affects the expression of BPGM mRNA CTD PMID:27424125 Bpgm Rat glycidyl methacrylate decreases expression ISO BPGM (Homo sapiens) 6480464 glycidyl methacrylate results in decreased expression of BPGM protein CTD PMID:36641056 Bpgm Rat glycitein multiple interactions ISO BPGM (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] affects the expression of BPGM mRNA CTD PMID:27424125 Bpgm Rat glycitin multiple interactions ISO BPGM (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] affects the expression of BPGM mRNA CTD PMID:27424125 Bpgm Rat hydralazine multiple interactions ISO BPGM (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of BPGM mRNA CTD PMID:17183730 Bpgm Rat indometacin increases expression EXP 6480464 Indomethacin results in increased expression of BPGM mRNA CTD PMID:36868495 Bpgm Rat leflunomide decreases expression ISO BPGM (Homo sapiens) 6480464 leflunomide results in decreased expression of BPGM mRNA CTD PMID:28988120 Bpgm Rat Licochalcone B increases expression ISO BPGM (Homo sapiens) 6480464 licochalcone B results in increased expression of BPGM mRNA CTD PMID:33647349 Bpgm Rat metformin decreases expression EXP 6480464 Metformin results in decreased expression of BPGM mRNA CTD PMID:31324951 Bpgm Rat methotrexate decreases expression EXP 6480464 Methotrexate results in decreased expression of BPGM mRNA CTD PMID:24136188 Bpgm Rat methyl methanesulfonate increases expression ISO BPGM (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of BPGM mRNA CTD PMID:23649840 Bpgm Rat methylisothiazolinone increases expression ISO BPGM (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of BPGM mRNA CTD PMID:31629900 Bpgm Rat N-acetyl-L-cysteine decreases expression ISO BPGM (Homo sapiens) 6480464 Acetylcysteine results in decreased expression of BPGM mRNA CTD PMID:16084531 Bpgm Rat okadaic acid increases expression ISO BPGM (Homo sapiens) 6480464 Okadaic Acid results in increased expression of BPGM mRNA CTD PMID:28939011 Bpgm Rat ozone decreases expression ISO Bpgm (Mus musculus) 6480464 Ozone results in decreased expression of BPGM mRNA CTD PMID:16183385 Bpgm Rat ozone multiple interactions ISO Bpgm (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of BPGM mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of BPGM mRNA CTD PMID:34911549 Bpgm Rat paracetamol decreases expression ISO Bpgm (Mus musculus) 6480464 Acetaminophen results in decreased expression of BPGM mRNA CTD PMID:17585979 Bpgm Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of BPGM mRNA CTD PMID:33387578 Bpgm Rat pirinixic acid multiple interactions ISO Bpgm (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of BPGM mRNA CTD PMID:19710929 Bpgm Rat pirinixic acid increases expression ISO Bpgm (Mus musculus) 6480464 pirinixic acid results in increased expression of BPGM mRNA CTD PMID:18301758 Bpgm Rat progesterone affects expression ISO Bpgm (Mus musculus) 6480464 Progesterone affects the expression of BPGM mRNA CTD PMID:17251523 Bpgm Rat progesterone multiple interactions ISO BPGM (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of BPGM mRNA CTD PMID:20660070 Bpgm Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of BPGM mRNA CTD PMID:28374803 Bpgm Rat senecionine increases expression ISO Bpgm (Mus musculus) 6480464 senecionine results in increased expression of BPGM protein CTD PMID:35357534 Bpgm Rat sodium arsenite increases expression ISO BPGM (Homo sapiens) 6480464 sodium arsenite results in increased expression of BPGM mRNA CTD PMID:23648393 and PMID:38568856 Bpgm Rat sodium arsenite multiple interactions ISO BPGM (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of BPGM mRNA CTD PMID:39836092 Bpgm Rat sodium dichromate increases expression ISO Bpgm (Mus musculus) 6480464 sodium bichromate results in increased expression of BPGM mRNA CTD PMID:31558096 Bpgm Rat sunitinib decreases expression ISO BPGM (Homo sapiens) 6480464 Sunitinib results in decreased expression of BPGM mRNA CTD PMID:31533062 Bpgm Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of BPGM mRNA CTD PMID:34492290 Bpgm Rat thiram increases expression ISO BPGM (Homo sapiens) 6480464 Thiram results in increased expression of BPGM mRNA CTD PMID:38568856 Bpgm Rat titanium dioxide increases expression ISO Bpgm (Mus musculus) 6480464 titanium dioxide results in increased expression of BPGM mRNA CTD PMID:23557971 Bpgm Rat tolcapone decreases expression EXP 6480464 tolcapone results in decreased expression of BPGM mRNA CTD PMID:24136188 Bpgm Rat triphenyl phosphate affects expression ISO BPGM (Homo sapiens) 6480464 triphenyl phosphate affects the expression of BPGM mRNA CTD PMID:37042841 Bpgm Rat tungsten decreases expression ISO Bpgm (Mus musculus) 6480464 Tungsten results in decreased expression of BPGM mRNA CTD PMID:30912803 Bpgm Rat urethane increases expression ISO BPGM (Homo sapiens) 6480464 Urethane results in increased expression of BPGM mRNA CTD PMID:28818685 Bpgm Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of BPGM mRNA CTD PMID:24136188 Bpgm Rat valproic acid multiple interactions ISO BPGM (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of BPGM mRNA CTD PMID:17183730 Bpgm Rat valproic acid increases expression ISO BPGM (Homo sapiens) 6480464 Valproic Acid results in increased expression of BPGM mRNA CTD PMID:29154799 Bpgm Rat valproic acid affects expression ISO BPGM (Homo sapiens) 6480464 Valproic Acid affects the expression of BPGM mRNA CTD PMID:25979313 Bpgm Rat zoledronic acid increases expression ISO BPGM (Homo sapiens) 6480464 zoledronic acid results in increased expression of BPGM mRNA CTD PMID:24714768
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) acrylamide (EXP) alpha-naphthoflavone (ISO) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) beta-naphthoflavone (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) buspirone (EXP) Butylbenzyl phthalate (EXP) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) captan (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlordecone (ISO) chromium(6+) (ISO) copper(II) sulfate (ISO) daidzein (ISO) daidzein 7-O-beta-D-glucoside (ISO) decabromodiphenyl ether (ISO) dibutyl phthalate (EXP,ISO) dicrotophos (ISO) diethyl phthalate (EXP) diisobutyl phthalate (EXP) diisononyl phthalate (EXP) dinophysistoxin 1 (ISO) dioxygen (ISO) doxorubicin (ISO) fenvalerate (EXP) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) genistein (ISO) genistein 7-O-beta-D-glucoside (ISO) glycidyl methacrylate (ISO) glycitein (ISO) glycitin (ISO) hydralazine (ISO) indometacin (EXP) leflunomide (ISO) Licochalcone B (ISO) metformin (EXP) methotrexate (EXP) methyl methanesulfonate (ISO) methylisothiazolinone (ISO) N-acetyl-L-cysteine (ISO) okadaic acid (ISO) ozone (ISO) paracetamol (EXP,ISO) pirinixic acid (ISO) progesterone (ISO) rotenone (EXP) senecionine (ISO) sodium arsenite (ISO) sodium dichromate (ISO) sunitinib (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) tolcapone (EXP) triphenyl phosphate (ISO) tungsten (ISO) urethane (ISO) valdecoxib (EXP) valproic acid (ISO) zoledronic acid (ISO)
1.
Compound heterozygosity in a complete erythrocyte bisphosphoglycerate mutase deficiency.
Lemarchandel V, etal., Blood. 1992 Nov 15;80(10):2643-9.
2.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
3.
Changes in enzyme activities involved in the degradation of 1,3-bisphosphoglycerate during erythropoiesis in rat bone marrow.
Pineda M, etal., Cell Biochem Funct. 1984 Oct;2(4):254-6.
4.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
5.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
6.
GOA pipeline
RGD automated data pipeline
7.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Comprehensive gene review and curation
RGD comprehensive gene curation
10.
Isolation, characterization, and structure of a mutant 89 Arg----Cys bisphosphoglycerate mutase. Implication of the active site in the mutation.
Rosa R, etal., J Biol Chem 1989 May 15;264(14):7837-43.
11.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Bpgm Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 64,106,809 - 64,135,749 (+) NCBI GRCr8 mRatBN7.2 4 63,139,730 - 63,168,581 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 63,140,018 - 63,168,581 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 68,098,223 - 68,126,740 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 64,013,920 - 64,042,437 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 62,416,337 - 62,444,854 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 61,912,210 - 61,940,697 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 61,912,210 - 61,940,696 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 61,650,881 - 61,679,069 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 61,858,884 - 61,888,007 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 62,135,013 - 62,164,136 (+) NCBI Celera 4 58,192,196 - 58,220,785 (+) NCBI Celera Cytogenetic Map 4 q22 NCBI
BPGM Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 134,646,853 - 134,679,816 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 134,646,811 - 134,679,816 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 134,331,605 - 134,364,568 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 133,982,095 - 134,015,108 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 7 129,068,953 - 129,101,988 (+) NCBI Celera Cytogenetic Map 7 q33 NCBI HuRef 7 128,633,382 - 128,666,417 (+) NCBI HuRef CHM1_1 7 134,265,830 - 134,298,456 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 135,954,938 - 135,987,472 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 133,675,849 - 133,708,886 (+) NCBI
Bpgm Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 34,453,291 - 34,482,071 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 34,453,142 - 34,482,548 (+) Ensembl GRCm39 Ensembl GRCm38 6 34,476,356 - 34,505,136 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 34,476,207 - 34,505,613 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 34,426,356 - 34,455,610 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 34,406,514 - 34,435,768 (+) NCBI MGSCv36 mm8 Celera 6 34,470,380 - 34,505,653 (+) NCBI Celera Cytogenetic Map 6 B1 NCBI cM Map 6 15.01 NCBI
Bpgm Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955494 7,866,693 - 7,883,641 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955494 7,867,295 - 7,889,440 (-) NCBI ChiLan1.0 ChiLan1.0
BPGM Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 171,460,435 - 171,495,458 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 23,470,693 - 23,505,705 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 126,605,151 - 126,637,934 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 139,111,512 - 139,144,487 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 139,123,318 - 139,144,487 (+) Ensembl panpan1.1 panPan2
BPGM Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 16 13,386,021 - 13,418,248 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 16 13,365,566 - 13,418,432 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 16 14,392,842 - 14,427,411 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 16 13,358,754 - 13,393,331 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 16 13,339,774 - 13,393,124 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 16 13,803,119 - 13,837,627 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 16 12,899,358 - 12,933,930 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 16 13,038,580 - 13,073,172 (-) NCBI UU_Cfam_GSD_1.0
Bpgm Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 21,009,042 - 21,032,454 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936579 1,141,598 - 1,164,630 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936579 1,141,637 - 1,164,554 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
BPGM Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 18 14,556,832 - 14,593,252 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 18 14,555,919 - 14,593,321 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 18 15,416,592 - 15,418,684 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BPGM Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 103,336,777 - 103,369,396 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 103,336,809 - 103,372,186 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666072 236,243 - 268,628 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Bpgm
.
Predicted Target Of
Count of predictions: 97 Count of miRNA genes: 80 Interacting mature miRNAs: 88 Transcripts: ENSRNOT00000013569 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1549843 Bw53 Body weight QTL 53 0.0001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 61697658 103194791 Rat 61445 Strs3 Sensitivity to stroke QTL 3 3 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 4 40433388 85433388 Rat 6893678 Bw108 Body weight QTL 108 2.6 0.006 body mass (VT:0001259) body weight (CMO:0000012) 4 43457976 88457976 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1358363 Sradr3 Stress Responsive Adrenal Weight QTL 3 6.19 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 4 57486946 102486946 Rat 61336 Bp21 Blood pressure QTL 21 4.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 57114705 78881294 Rat 1549839 Bw52 Body weight QTL 52 0.0001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 61697658 115089733 Rat 6909128 Pancm4 Pancreatic morphology QTL 4 11.35 pancreas mass (VT:0010144) pancreas wet weight (CMO:0000626) 4 26907285 75585128 Rat 61475 Aia2 Adjuvant induced arthritis QTL 2 5.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 39505275 73892441 Rat 8694439 Bw168 Body weight QTL 168 9.57 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 4 40433414 85433414 Rat 8655906 Rf60 Renal function QTL 60 3.8 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 4 29494195 81006281 Rat 6909122 Insul22 Insulin level QTL 22 4.63 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 4 26907285 75585128 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 2300179 Bmd50 Bone mineral density QTL 50 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 4 60928534 105928534 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 70192 BpQTLcluster5 Blood pressure QTL cluster 5 4.183 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 4 62933508 114921294 Rat 1300139 Hrtrt6 Heart rate QTL 6 2.85 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 39524264 116179656 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 1578657 Bss12 Bone structure and strength QTL 12 8.9 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 4 60220938 105220938 Rat 1578658 Bss13 Bone structure and strength QTL 13 8 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 4 60220938 105220938 Rat 4889969 Bss96 Bone structure and strength QTL 96 4.9 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 4 56647776 78882945 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 4889972 Bss97 Bone structure and strength QTL 97 5.6 tibia size trait (VT:0100001) tibia total bone volume (CMO:0001724) 4 56647776 78882945 Rat 6478684 Anxrr30 Anxiety related response QTL 30 0.00087 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 5685012 Bmd87 Bone mineral density QTL 87 5.1 tibia mineral mass (VT:1000283) bone mineral content (CMO:0001554) 4 56647776 78882945 Rat 5685009 Bmd86 Bone mineral density QTL 86 3.7 tibia mineral mass (VT:1000283) bone mineral density (CMO:0001226) 4 56647776 78882945 Rat 1331807 Rf31 Renal function QTL 31 2.988 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 4 39524264 74726312 Rat 8552782 Vie1 Viral induced encephalitis QTL 1 26.4 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 34430484 82490359 Rat 634311 Sach7 Saccharin preference QTL 7 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 57114432 81266970 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 631261 Tcas3 Tongue tumor susceptibility QTL 3 6.88 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 4 10814170 91360527 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 6478772 Anxrr49 Anxiety related response QTL 49 0.15488 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 8655961 Kidm43 Kidney mass QTL 43 18 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 36303261 103194984 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 8552801 Bw143 Body weight QTL 143 7.3 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 4 34430484 82490359 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 8552807 Vie4 Viral induced encephalitis QTL 4 7.3 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 62933508 82490359 Rat 619616 Bp79 Blood pressure QTL 79 0.0292 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 5214602 78882945 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 61418 Pia5 Pristane induced arthritis QTL 5 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 62277855 128289560 Rat 631651 Bp124 Blood pressure QTL 124 3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 62879517 107879517 Rat 8552809 Vie5 Viral induced encephalitis QTL 5 25.3 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 34430484 82490359 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1558651 Swd3 Spike wave discharge measurement QTL 3 4.62 0.000024 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 4 58432133 92991462 Rat 1358203 Stl19 Serum triglyceride level QTL 19 2.8 0.002 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5218294 65958103 Rat 1641833 Alc21 Alcohol consumption QTL 21 8.6 0.0001 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 56698790 126192555 Rat 631546 Bp86 Blood pressure QTL 86 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 57114432 91360801 Rat 6478743 Anxrr40 Anxiety related response QTL 40 0.83076 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 7394826 Bw126 Body weight QTL 126 0.002 body mass (VT:0001259) body weight gain (CMO:0000420) 4 62933269 87483707 Rat 12798520 Anxrr55 Anxiety related response QTL 55 4.45 0.01 locomotor behavior trait (VT:0001392) number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715) 4 32583980 114627242 Rat 631671 Iddm11 Insulin dependent diabetes mellitus QTL 11 3.6 0.0012 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 58635877 78886137 Rat
BF393409
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 63,162,184 - 63,162,281 (+) MAPPER mRatBN7.2 Rnor_6.0 4 61,934,290 - 61,934,386 NCBI Rnor6.0 Rnor_5.0 4 61,672,961 - 61,673,057 UniSTS Rnor5.0 RGSC_v3.4 4 61,880,960 - 61,881,056 UniSTS RGSC3.4 Celera 4 58,214,270 - 58,214,366 UniSTS RH 3.4 Map 4 376.6 UniSTS Cytogenetic Map 4 q22 UniSTS
RH138377
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 63,167,775 - 63,167,895 (+) MAPPER mRatBN7.2 Rnor_6.0 4 61,939,892 - 61,940,011 NCBI Rnor6.0 Rnor_5.0 4 61,678,264 - 61,678,383 UniSTS Rnor5.0 RGSC_v3.4 4 61,887,202 - 61,887,321 UniSTS RGSC3.4 Celera 4 58,219,980 - 58,220,099 UniSTS RH 3.4 Map 4 376.0 UniSTS Cytogenetic Map 4 q22 UniSTS
RH132040
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 63,168,301 - 63,168,499 (+) MAPPER mRatBN7.2 Rnor_6.0 4 61,940,418 - 61,940,615 NCBI Rnor6.0 Rnor_5.0 4 61,678,790 - 61,678,987 UniSTS Rnor5.0 RGSC_v3.4 4 61,887,728 - 61,887,925 UniSTS RGSC3.4 Celera 4 58,220,506 - 58,220,703 UniSTS RH 3.4 Map 4 376.0 UniSTS Cytogenetic Map 4 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000013569 ⟹ ENSRNOP00000013566
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 63,140,018 - 63,168,581 (+) Ensembl Rnor_6.0 Ensembl 4 61,912,210 - 61,940,696 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000090717 ⟹ ENSRNOP00000070911
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 63,151,908 - 63,168,459 (+) Ensembl Rnor_6.0 Ensembl 4 61,924,013 - 61,940,573 (+) Ensembl
RefSeq Acc Id:
NM_199382 ⟹ NP_955414
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 64,107,277 - 64,135,749 (+) NCBI mRatBN7.2 4 63,140,109 - 63,168,581 (+) NCBI Rnor_6.0 4 61,912,210 - 61,940,697 (+) NCBI Rnor_5.0 4 61,650,881 - 61,679,069 (+) NCBI RGSC_v3.4 4 61,858,884 - 61,888,007 (+) RGD Celera 4 58,192,196 - 58,220,785 (+) RGD
Sequence:
GGGGGAATCCTCCCTGGCACCTGCAGCACGGCGTCGCTGAGGACTGGGTGCTACTGGTGGTTTCCTTGCAGCTGTACTGCTGTTCTCGAACCTCACCCAATTGAGAACTCCAGGGCAGCCCAGCCACC
hide sequence
RefSeq Acc Id:
XM_006236259 ⟹ XP_006236321
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 64,117,638 - 64,135,749 (+) NCBI mRatBN7.2 4 63,150,852 - 63,168,581 (+) NCBI Rnor_6.0 4 61,922,941 - 61,940,697 (+) NCBI Rnor_5.0 4 61,650,881 - 61,679,069 (+) NCBI
Sequence:
CACCGCACCTCGGTGAAGCGCTCTTCCAGGGGTAGACTGATGCAGCCGGCTCTCCAGGTTCTCCGGAGACAGAGTAGACAAGGGCAACAGCAGAAGGGAGTTCAGACTCGCATAGCGTTGTTGTCCAA
hide sequence
RefSeq Acc Id:
XM_039107293 ⟹ XP_038963221
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 64,106,809 - 64,135,749 (+) NCBI mRatBN7.2 4 63,139,730 - 63,168,581 (+) NCBI
RefSeq Acc Id:
XM_063285747 ⟹ XP_063141817
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 64,107,231 - 64,135,749 (+) NCBI
RefSeq Acc Id:
NP_955414 ⟸ NM_199382
- UniProtKB:
Q6P6G4 (UniProtKB/TrEMBL), F7F6N0 (UniProtKB/TrEMBL)
- Sequence:
MSKHRLIILRHGEGQWNKENRFCSWVDQKLNSDGLEEARNCGRQLKALNFEFDLVFTSILNRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNREKMALNHGEEQVRLWRRSYNVTPPPIEE
hide sequence
RefSeq Acc Id:
XP_006236321 ⟸ XM_006236259
- Peptide Label:
isoform X1
- UniProtKB:
Q6P6G4 (UniProtKB/TrEMBL), F7F6N0 (UniProtKB/TrEMBL)
- Sequence:
MSKHRLIILRHGEGQWNKENRFCSWVDQKLNSDGLEEARNCGRQLKALNFEFDLVFTSILNRSI
hide sequence
Ensembl Acc Id:
ENSRNOP00000070911 ⟸ ENSRNOT00000090717
Ensembl Acc Id:
ENSRNOP00000013566 ⟸ ENSRNOT00000013569
RefSeq Acc Id:
XP_038963221 ⟸ XM_039107293
- Peptide Label:
isoform X1
- UniProtKB:
Q6P6G4 (UniProtKB/TrEMBL), F7F6N0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063141817 ⟸ XM_063285747
- Peptide Label:
isoform X1
- UniProtKB:
F7F6N0 (UniProtKB/TrEMBL), Q6P6G4 (UniProtKB/TrEMBL)
RGD ID: 13692954 Promoter ID: EPDNEW_R3478 Type: initiation region Name: Bpgm_1 Description: bisphosphoglycerate mutase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 61,912,210 - 61,912,270 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-02
Bpgm
bisphosphoglycerate mutase
Bpgm
2,3-bisphosphoglycerate mutase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Bpgm
2,3-bisphosphoglycerate mutase
LOC296973
Symbol updated
1299863 APPROVED
